Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MV38

Protein Details
Accession A0A4S2MV38    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
34-68RPQLQHARHHHHRHHYRRPQDRYHSSAPRRKRQHPBasic
NLS Segment(s)
PositionSequence
41-68RHHHHRHHYRRPQDRYHSSAPRRKRQHP
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8, plas 2
Family & Domain DBs
Amino Acid Sequences MLQRPLLHIAHFPPTLHNPLHLTHNPPQRPPHPRPQLQHARHHHHRHHYRRPQDRYHSSAPRRKRQHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.28
4 0.28
5 0.24
6 0.24
7 0.31
8 0.29
9 0.3
10 0.33
11 0.42
12 0.42
13 0.43
14 0.47
15 0.47
16 0.54
17 0.53
18 0.57
19 0.57
20 0.61
21 0.61
22 0.65
23 0.68
24 0.65
25 0.7
26 0.67
27 0.67
28 0.7
29 0.76
30 0.72
31 0.73
32 0.78
33 0.78
34 0.81
35 0.82
36 0.83
37 0.85
38 0.86
39 0.85
40 0.85
41 0.83
42 0.79
43 0.78
44 0.79
45 0.78
46 0.79
47 0.79
48 0.79