Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MS32

Protein Details
Accession A0A4S2MS32    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-109YQGALYKSRRRMRRRMRRRRRRRTRRRTRKRRRRPKPRRKPSLRKPLPLSPKTBasic
NLS Segment(s)
PositionSequence
63-109KSRRRMRRRMRRRRRRRTRRRTRKRRRRPKPRRKPSLRKPLPLSPKT
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
Amino Acid Sequences MVSFHCESCNDVVKKPKLDAHKGRCRGAVFSCIDCSTTFQGTEYRSHTSCISEEQKYQGALYKSRRRMRRRMRRRRRRRTRRRTRKRRRRPKPRRKPSLRKPLPLSPKTSRWLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.5
4 0.49
5 0.57
6 0.63
7 0.64
8 0.68
9 0.7
10 0.7
11 0.69
12 0.62
13 0.55
14 0.47
15 0.43
16 0.36
17 0.31
18 0.31
19 0.26
20 0.26
21 0.23
22 0.23
23 0.18
24 0.17
25 0.15
26 0.13
27 0.16
28 0.17
29 0.2
30 0.2
31 0.21
32 0.2
33 0.22
34 0.21
35 0.2
36 0.19
37 0.21
38 0.22
39 0.2
40 0.2
41 0.21
42 0.22
43 0.21
44 0.2
45 0.19
46 0.16
47 0.2
48 0.27
49 0.34
50 0.41
51 0.48
52 0.57
53 0.6
54 0.69
55 0.76
56 0.79
57 0.81
58 0.84
59 0.89
60 0.91
61 0.96
62 0.97
63 0.97
64 0.97
65 0.97
66 0.97
67 0.97
68 0.97
69 0.98
70 0.98
71 0.98
72 0.98
73 0.98
74 0.98
75 0.97
76 0.97
77 0.98
78 0.97
79 0.97
80 0.97
81 0.97
82 0.97
83 0.97
84 0.96
85 0.96
86 0.94
87 0.92
88 0.88
89 0.87
90 0.86
91 0.8
92 0.77
93 0.73
94 0.7
95 0.67