Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SI26

Protein Details
Accession A0A4V3SI26    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-49TPPPSNKRAGWHHRFHRKDPBasic
181-213RFEISEKTLRKRRKRYKKDRRRLRRMAEEGKSFBasic
NLS Segment(s)
PositionSequence
189-206LRKRRKRYKKDRRRLRRM
Subcellular Location(s) mito 13, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MFSRQRLPSQNVYTEKPLPPLPSPLTAAATPPPSNKRAGWHHRFHRKDPPPPAPPTAPQHPAEHAPPLPDPLPPHYIPPPPSLRPPPHVTSQPPSRKLFHLFTISRSSPQPLIPTHPSQVTTVHLLRSRPPELGATTYTLTPAAVTPAPDTAVVAVLDAGIVATDWAVPGGAVRVVTDQERFEISEKTLRKRRKRYKKDRRRLRRMAEEGKSFAELGEGEEVMFECVEEASEVLEELVGLDLEELGLDTNGEVEWDEVEFSPPESEDEEIVEEVWDDGIRMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.49
4 0.46
5 0.42
6 0.4
7 0.42
8 0.39
9 0.37
10 0.38
11 0.36
12 0.35
13 0.31
14 0.3
15 0.27
16 0.28
17 0.27
18 0.3
19 0.33
20 0.31
21 0.35
22 0.35
23 0.39
24 0.44
25 0.53
26 0.56
27 0.61
28 0.69
29 0.76
30 0.81
31 0.79
32 0.79
33 0.78
34 0.78
35 0.78
36 0.77
37 0.74
38 0.73
39 0.73
40 0.66
41 0.63
42 0.6
43 0.57
44 0.53
45 0.48
46 0.45
47 0.42
48 0.41
49 0.37
50 0.36
51 0.29
52 0.27
53 0.25
54 0.25
55 0.23
56 0.22
57 0.22
58 0.21
59 0.26
60 0.24
61 0.27
62 0.29
63 0.33
64 0.34
65 0.38
66 0.39
67 0.36
68 0.43
69 0.47
70 0.47
71 0.48
72 0.52
73 0.49
74 0.48
75 0.5
76 0.48
77 0.47
78 0.53
79 0.55
80 0.55
81 0.55
82 0.52
83 0.51
84 0.52
85 0.47
86 0.41
87 0.4
88 0.35
89 0.35
90 0.4
91 0.37
92 0.33
93 0.32
94 0.3
95 0.23
96 0.24
97 0.24
98 0.18
99 0.23
100 0.26
101 0.27
102 0.27
103 0.26
104 0.26
105 0.23
106 0.23
107 0.19
108 0.19
109 0.17
110 0.18
111 0.19
112 0.18
113 0.22
114 0.26
115 0.26
116 0.22
117 0.22
118 0.2
119 0.19
120 0.21
121 0.17
122 0.14
123 0.13
124 0.13
125 0.12
126 0.1
127 0.09
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.07
137 0.07
138 0.05
139 0.06
140 0.05
141 0.05
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.03
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.07
164 0.09
165 0.08
166 0.09
167 0.1
168 0.11
169 0.12
170 0.12
171 0.13
172 0.19
173 0.22
174 0.29
175 0.36
176 0.45
177 0.53
178 0.63
179 0.73
180 0.78
181 0.86
182 0.9
183 0.93
184 0.95
185 0.96
186 0.96
187 0.97
188 0.96
189 0.95
190 0.93
191 0.92
192 0.9
193 0.88
194 0.83
195 0.76
196 0.67
197 0.58
198 0.49
199 0.38
200 0.28
201 0.2
202 0.13
203 0.11
204 0.1
205 0.09
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.06
212 0.04
213 0.04
214 0.05
215 0.05
216 0.04
217 0.04
218 0.05
219 0.05
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.03
232 0.03
233 0.04
234 0.04
235 0.03
236 0.04
237 0.04
238 0.04
239 0.05
240 0.05
241 0.05
242 0.06
243 0.07
244 0.07
245 0.1
246 0.1
247 0.11
248 0.12
249 0.12
250 0.13
251 0.13
252 0.14
253 0.12
254 0.14
255 0.15
256 0.14
257 0.13
258 0.12
259 0.1
260 0.1
261 0.1
262 0.08