Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MV60

Protein Details
Accession A0A4S2MV60   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-59NGRKRGSMNTIKRKKERKKTKNPKMRRVSRSKTEKQTEBasic
NLS Segment(s)
PositionSequence
21-53NNGRKRGSMNTIKRKKERKKTKNPKMRRVSRSK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.833, mito 4
Family & Domain DBs
Amino Acid Sequences MEQQEPWQRAEEKEKWRSNINNGRKRGSMNTIKRKKERKKTKNPKMRRVSRSKTEKQTECWLKIEEAGWAPGRSSFPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.58
3 0.63
4 0.64
5 0.65
6 0.67
7 0.68
8 0.67
9 0.65
10 0.65
11 0.59
12 0.57
13 0.51
14 0.49
15 0.48
16 0.49
17 0.57
18 0.62
19 0.67
20 0.73
21 0.79
22 0.81
23 0.82
24 0.83
25 0.83
26 0.86
27 0.9
28 0.93
29 0.93
30 0.93
31 0.93
32 0.92
33 0.91
34 0.89
35 0.88
36 0.85
37 0.84
38 0.84
39 0.82
40 0.81
41 0.8
42 0.74
43 0.69
44 0.72
45 0.7
46 0.63
47 0.58
48 0.5
49 0.41
50 0.39
51 0.35
52 0.27
53 0.21
54 0.22
55 0.21
56 0.19
57 0.19
58 0.2
59 0.24