Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MMV2

Protein Details
Accession A0A4S2MMV2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-51GSSCRRWRLSSRWRFRRRTARTREICHydrophilic
102-125HRVCGARGRRRRVEGRRGRRWSMABasic
NLS Segment(s)
PositionSequence
108-121RGRRRRVEGRRGRR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MGRGIRGSGESRHPFSQLTWRAGAAGSSCRRWRLSSRWRFRRRTARTREICVCLLCLHPGNDLQQCSAVFSSRELPGRQPLSCLIFDHLEWPASSELVEAMHRVCGARGRRRRVEGRRGRRWSMAVGGGGEEGEIVVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.42
4 0.39
5 0.38
6 0.34
7 0.32
8 0.31
9 0.31
10 0.29
11 0.21
12 0.22
13 0.2
14 0.25
15 0.27
16 0.3
17 0.31
18 0.34
19 0.39
20 0.41
21 0.49
22 0.55
23 0.64
24 0.72
25 0.8
26 0.83
27 0.86
28 0.86
29 0.85
30 0.85
31 0.83
32 0.83
33 0.79
34 0.79
35 0.75
36 0.68
37 0.6
38 0.5
39 0.41
40 0.31
41 0.26
42 0.21
43 0.17
44 0.13
45 0.12
46 0.12
47 0.14
48 0.16
49 0.15
50 0.14
51 0.14
52 0.13
53 0.14
54 0.13
55 0.11
56 0.08
57 0.09
58 0.11
59 0.12
60 0.14
61 0.14
62 0.15
63 0.21
64 0.23
65 0.22
66 0.21
67 0.21
68 0.21
69 0.21
70 0.21
71 0.16
72 0.15
73 0.15
74 0.15
75 0.14
76 0.11
77 0.11
78 0.12
79 0.1
80 0.09
81 0.09
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.14
93 0.21
94 0.31
95 0.4
96 0.48
97 0.55
98 0.63
99 0.72
100 0.76
101 0.79
102 0.8
103 0.82
104 0.84
105 0.84
106 0.81
107 0.76
108 0.69
109 0.61
110 0.55
111 0.48
112 0.39
113 0.32
114 0.27
115 0.23
116 0.2
117 0.16
118 0.1
119 0.06