Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MLQ3

Protein Details
Accession A0A4S2MLQ3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
209-228EEERGKEKRRGGKRDEMGREBasic
NLS Segment(s)
PositionSequence
213-222GKEKRRGGKR
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008580  PPPDE_dom  
IPR042266  PPPDE_sf  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05903  Peptidase_C97  
PROSITE View protein in PROSITE  
PS51858  PPPDE  
Amino Acid Sequences MPPTTRTSTASTTKTPVHINVYDLLPPGRLSNILWTFGTGLLHTGVVIGDKEYAFGGHDLEAVTGVYSTKPRTTPPGGTFRTEVLHGFTYMGEEEREGVIKEASKLFTGPSYNLLTRNCNHFTSHLCLALTGYPAPKWINRAAGIGGAIPCVVPAGWVEPPECDVSDGEEDEERARLTGRRGGGRAEYQMQLEGPWSAVMSDDEEMSDEEERGKEKRRGGKRDEMGRELPEAERAQLERLEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.39
4 0.38
5 0.35
6 0.34
7 0.33
8 0.31
9 0.29
10 0.28
11 0.24
12 0.18
13 0.17
14 0.16
15 0.14
16 0.13
17 0.12
18 0.2
19 0.21
20 0.23
21 0.22
22 0.22
23 0.22
24 0.22
25 0.22
26 0.12
27 0.11
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.08
46 0.08
47 0.07
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.09
56 0.12
57 0.13
58 0.15
59 0.22
60 0.26
61 0.32
62 0.36
63 0.44
64 0.43
65 0.44
66 0.44
67 0.38
68 0.35
69 0.28
70 0.23
71 0.16
72 0.15
73 0.13
74 0.12
75 0.11
76 0.1
77 0.1
78 0.1
79 0.07
80 0.06
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.1
90 0.1
91 0.1
92 0.1
93 0.1
94 0.11
95 0.11
96 0.1
97 0.12
98 0.14
99 0.15
100 0.18
101 0.19
102 0.2
103 0.2
104 0.25
105 0.24
106 0.23
107 0.23
108 0.21
109 0.23
110 0.25
111 0.25
112 0.2
113 0.18
114 0.16
115 0.16
116 0.15
117 0.13
118 0.09
119 0.08
120 0.07
121 0.09
122 0.1
123 0.1
124 0.13
125 0.14
126 0.17
127 0.17
128 0.18
129 0.17
130 0.16
131 0.15
132 0.13
133 0.11
134 0.08
135 0.07
136 0.05
137 0.05
138 0.04
139 0.04
140 0.03
141 0.03
142 0.06
143 0.07
144 0.08
145 0.09
146 0.09
147 0.11
148 0.12
149 0.11
150 0.1
151 0.09
152 0.11
153 0.12
154 0.12
155 0.12
156 0.11
157 0.11
158 0.11
159 0.12
160 0.09
161 0.08
162 0.09
163 0.1
164 0.13
165 0.17
166 0.21
167 0.24
168 0.25
169 0.28
170 0.3
171 0.31
172 0.32
173 0.3
174 0.27
175 0.24
176 0.23
177 0.21
178 0.17
179 0.15
180 0.12
181 0.09
182 0.08
183 0.07
184 0.06
185 0.07
186 0.07
187 0.08
188 0.09
189 0.08
190 0.08
191 0.09
192 0.09
193 0.1
194 0.11
195 0.09
196 0.1
197 0.11
198 0.14
199 0.16
200 0.24
201 0.28
202 0.35
203 0.45
204 0.53
205 0.61
206 0.67
207 0.74
208 0.75
209 0.8
210 0.79
211 0.76
212 0.7
213 0.62
214 0.57
215 0.48
216 0.4
217 0.35
218 0.29
219 0.25
220 0.24
221 0.23
222 0.24