Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MS15

Protein Details
Accession A0A4S2MS15    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-113SSSSSKTARRSRLKKQKEEADSRSRKKKQTQEAERRSRLKKQKEEAERRSRKKKQKEEAERRSRKKKQKEETERRRTRNVHBasic
NLS Segment(s)
PositionSequence
38-110KTARRSRLKKQKEEADSRSRKKKQTQEAERRSRLKKQKEEAERRSRKKKQKEEAERRSRKKKQKEETERRRTR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTRTMQTNRREMQKTPIEGSKKRGDTEKQVGSSSSSSKTARRSRLKKQKEEADSRSRKKKQTQEAERRSRLKKQKEEAERRSRKKKQKEEAERRSRKKKQKEETERRRTRNVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.55
4 0.53
5 0.52
6 0.57
7 0.56
8 0.51
9 0.48
10 0.51
11 0.48
12 0.5
13 0.55
14 0.55
15 0.48
16 0.46
17 0.44
18 0.4
19 0.37
20 0.31
21 0.24
22 0.21
23 0.2
24 0.23
25 0.31
26 0.36
27 0.44
28 0.52
29 0.57
30 0.64
31 0.74
32 0.8
33 0.8
34 0.81
35 0.8
36 0.77
37 0.78
38 0.74
39 0.73
40 0.73
41 0.7
42 0.72
43 0.68
44 0.66
45 0.67
46 0.69
47 0.68
48 0.7
49 0.75
50 0.76
51 0.81
52 0.85
53 0.83
54 0.82
55 0.76
56 0.74
57 0.73
58 0.71
59 0.7
60 0.69
61 0.72
62 0.76
63 0.82
64 0.83
65 0.85
66 0.85
67 0.85
68 0.88
69 0.88
70 0.87
71 0.88
72 0.89
73 0.88
74 0.89
75 0.91
76 0.92
77 0.93
78 0.94
79 0.94
80 0.92
81 0.92
82 0.91
83 0.89
84 0.89
85 0.89
86 0.88
87 0.9
88 0.92
89 0.93
90 0.94
91 0.95
92 0.95
93 0.9