Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MHA2

Protein Details
Accession A0A4S2MHA2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-116AAREEWFKKRLEKRRAKEEAEKVKTBasic
NLS Segment(s)
PositionSequence
99-111KKRLEKRRAKEEA
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MSGPSTATVPDSSSPSQPSLLTRNPLPLSAAQEAQVRDLYYARVRGLCAEEIRIFADCARGKTVSATWMCRQERQAMNRCMIAQATPENMDAAREEWFKKRLEKRRAKEEAEKVKTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.24
5 0.25
6 0.27
7 0.29
8 0.3
9 0.29
10 0.34
11 0.34
12 0.33
13 0.31
14 0.27
15 0.28
16 0.26
17 0.25
18 0.2
19 0.23
20 0.22
21 0.22
22 0.21
23 0.15
24 0.14
25 0.14
26 0.14
27 0.13
28 0.15
29 0.14
30 0.14
31 0.14
32 0.14
33 0.16
34 0.16
35 0.14
36 0.15
37 0.14
38 0.14
39 0.15
40 0.13
41 0.11
42 0.09
43 0.15
44 0.13
45 0.14
46 0.15
47 0.15
48 0.14
49 0.15
50 0.16
51 0.15
52 0.16
53 0.19
54 0.19
55 0.28
56 0.29
57 0.3
58 0.31
59 0.34
60 0.39
61 0.43
62 0.5
63 0.45
64 0.46
65 0.45
66 0.43
67 0.36
68 0.3
69 0.23
70 0.15
71 0.13
72 0.14
73 0.13
74 0.13
75 0.13
76 0.12
77 0.13
78 0.11
79 0.1
80 0.12
81 0.13
82 0.15
83 0.2
84 0.24
85 0.27
86 0.36
87 0.45
88 0.52
89 0.61
90 0.7
91 0.73
92 0.8
93 0.86
94 0.84
95 0.84
96 0.84
97 0.84