Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6RHB9

Protein Details
Accession A0A4V6RHB9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-61LPGFANHRPKSKRRPKLPQIPLVWAHydrophilic
NLS Segment(s)
PositionSequence
44-52RPKSKRRPK
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MEYTTSIRRRSSPSNNRRSPSAMRNSPRSDPGSINDLPGFANHRPKSKRRPKLPQIPLVWARDETPPDGTAHLSPIMGYESGNLLNPYCGPAACLSPSGSFDSLVSDAASSSDLALIFPRAVQSVPTLTPSIPEPPPPLEFQFYQPESQNRWSSEPPEYQPPISEEKERDPTPVPEPTSQPVHTDYQHDHYQLQVSGYQMEAMHAIPVDCQNWNEGWYMSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.78
4 0.76
5 0.72
6 0.69
7 0.67
8 0.67
9 0.65
10 0.63
11 0.69
12 0.7
13 0.68
14 0.67
15 0.61
16 0.53
17 0.46
18 0.43
19 0.4
20 0.35
21 0.33
22 0.27
23 0.24
24 0.2
25 0.19
26 0.21
27 0.18
28 0.28
29 0.28
30 0.37
31 0.43
32 0.52
33 0.62
34 0.68
35 0.75
36 0.75
37 0.84
38 0.86
39 0.9
40 0.9
41 0.88
42 0.81
43 0.78
44 0.73
45 0.65
46 0.56
47 0.45
48 0.38
49 0.32
50 0.3
51 0.23
52 0.2
53 0.18
54 0.17
55 0.17
56 0.17
57 0.14
58 0.14
59 0.13
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.09
80 0.09
81 0.1
82 0.09
83 0.1
84 0.11
85 0.13
86 0.12
87 0.11
88 0.1
89 0.11
90 0.1
91 0.1
92 0.08
93 0.06
94 0.06
95 0.06
96 0.06
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.08
112 0.08
113 0.1
114 0.11
115 0.1
116 0.11
117 0.11
118 0.15
119 0.13
120 0.15
121 0.15
122 0.17
123 0.19
124 0.21
125 0.22
126 0.21
127 0.21
128 0.23
129 0.28
130 0.27
131 0.27
132 0.28
133 0.3
134 0.31
135 0.36
136 0.37
137 0.32
138 0.35
139 0.35
140 0.35
141 0.37
142 0.37
143 0.34
144 0.38
145 0.38
146 0.34
147 0.34
148 0.33
149 0.34
150 0.32
151 0.33
152 0.28
153 0.32
154 0.39
155 0.38
156 0.38
157 0.35
158 0.36
159 0.36
160 0.39
161 0.37
162 0.33
163 0.36
164 0.37
165 0.39
166 0.36
167 0.34
168 0.31
169 0.31
170 0.3
171 0.31
172 0.3
173 0.31
174 0.34
175 0.33
176 0.3
177 0.28
178 0.3
179 0.27
180 0.25
181 0.2
182 0.17
183 0.16
184 0.16
185 0.16
186 0.13
187 0.12
188 0.11
189 0.1
190 0.1
191 0.09
192 0.09
193 0.09
194 0.12
195 0.13
196 0.14
197 0.14
198 0.16
199 0.16
200 0.17
201 0.18