Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N734

Protein Details
Accession A0A4S2N734   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-98EEGDRLRKERERREKLKEGEEDAcidic
NLS Segment(s)
PositionSequence
82-93LRKERERREKLK
Subcellular Location(s) cyto 9.5, mito 8, cyto_nucl 5.5, plas 2, extr 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013945  Pkr1  
Gene Ontology GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF08636  Pkr1  
Amino Acid Sequences MASFLTDIWSSVFEGGTNQSLLIATYSSFAALQTTLIGLLFATGSYHFVALNVICGGLWAAVAWFVKELEQVKRLEEEGDRLRKERERREKLKEGEEDEGKKEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.11
5 0.1
6 0.1
7 0.1
8 0.1
9 0.09
10 0.07
11 0.05
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.08
55 0.11
56 0.13
57 0.17
58 0.17
59 0.18
60 0.2
61 0.2
62 0.2
63 0.18
64 0.21
65 0.25
66 0.33
67 0.33
68 0.34
69 0.38
70 0.43
71 0.51
72 0.56
73 0.59
74 0.62
75 0.68
76 0.76
77 0.82
78 0.81
79 0.81
80 0.77
81 0.7
82 0.67
83 0.66
84 0.6