Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N6E9

Protein Details
Accession A0A4S2N6E9    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-43LVWKIPWRLSPPQKYRHRKRLQRVDEVIDHydrophilic
78-107YTMFDRKSKTYRKGVHKTPKWTRISQRLNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, mito_nucl 12.833, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRASNPLFGGLVWKIPWRLSPPQKYRHRKRLQRVDEVIDTLESALKKQGESIAAIERWRHEMPTEAEMEARDKYTMFDRKSKTYRKGVHKTPKWTRISQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.17
5 0.16
6 0.17
7 0.2
8 0.22
9 0.31
10 0.39
11 0.49
12 0.54
13 0.63
14 0.73
15 0.81
16 0.86
17 0.87
18 0.88
19 0.87
20 0.9
21 0.91
22 0.88
23 0.87
24 0.81
25 0.75
26 0.65
27 0.56
28 0.46
29 0.34
30 0.26
31 0.16
32 0.14
33 0.09
34 0.07
35 0.09
36 0.09
37 0.09
38 0.09
39 0.11
40 0.1
41 0.1
42 0.12
43 0.12
44 0.12
45 0.13
46 0.13
47 0.12
48 0.16
49 0.16
50 0.15
51 0.12
52 0.16
53 0.19
54 0.21
55 0.22
56 0.17
57 0.17
58 0.17
59 0.18
60 0.14
61 0.12
62 0.1
63 0.08
64 0.1
65 0.17
66 0.24
67 0.26
68 0.33
69 0.37
70 0.45
71 0.54
72 0.61
73 0.62
74 0.64
75 0.7
76 0.73
77 0.78
78 0.8
79 0.83
80 0.83
81 0.85
82 0.86
83 0.86
84 0.82
85 0.81
86 0.8
87 0.8
88 0.81
89 0.79
90 0.8