Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N3W6

Protein Details
Accession A0A4S2N3W6    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
259-280KEYSKFAKDRKKSKKVDDDMSSHydrophilic
293-316VGSTMSVSKRRRRREKSGTATSGYHydrophilic
NLS Segment(s)
PositionSequence
301-308KRRRRREK
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007307  Ltv1  
Gene Ontology GO:0042274  P:ribosomal small subunit biogenesis  
Pfam View protein in Pfam  
PF04180  LTV  
Amino Acid Sequences MAPPKKWIDKKSAQNFQLRYRSQNDPLIHDSSAADFVFAPVEAPNASKKGKTKNDLEGELDVSTIRPNEGEAANYGIYFDDSKYDYMQHLRDIGEGGNGVDAVFIEAKQSKQKGKKKMTLEEALIAEDEQKKKNDLLMPKELLPSEKLVKRTWQDQMDIPASLQGFQPDMDPRLREVLEALEDDAYVEEDEDLFGELAQGGEVDEDDFEDMFFDEEDEDGYASDATEKAPQQPSQTPVAGEEKNQESKTEPAGSEDWMKEYSKFAKDRKKSKKVDDDMSSMADTMSFGGLSSVGSTMSVSKRRRRREKSGTATSGYSMTSSSLFRTEGLTLLDDRFDKIEEMYNEDSEEEDRPDGPLPETRKDFDRILDEFLGQYNVVGSTPARARVKRGAQLTGMEQLDEIRKGLGKARIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.77
3 0.76
4 0.77
5 0.69
6 0.64
7 0.6
8 0.61
9 0.59
10 0.62
11 0.55
12 0.51
13 0.53
14 0.5
15 0.45
16 0.38
17 0.33
18 0.26
19 0.27
20 0.2
21 0.16
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.07
28 0.08
29 0.08
30 0.1
31 0.13
32 0.17
33 0.19
34 0.22
35 0.29
36 0.38
37 0.47
38 0.53
39 0.56
40 0.61
41 0.67
42 0.66
43 0.63
44 0.54
45 0.47
46 0.39
47 0.33
48 0.23
49 0.15
50 0.14
51 0.11
52 0.09
53 0.07
54 0.08
55 0.11
56 0.12
57 0.13
58 0.12
59 0.15
60 0.15
61 0.15
62 0.14
63 0.11
64 0.11
65 0.11
66 0.1
67 0.1
68 0.11
69 0.12
70 0.13
71 0.15
72 0.16
73 0.2
74 0.22
75 0.21
76 0.22
77 0.21
78 0.21
79 0.2
80 0.18
81 0.14
82 0.13
83 0.11
84 0.08
85 0.08
86 0.07
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.08
93 0.09
94 0.11
95 0.18
96 0.22
97 0.29
98 0.39
99 0.47
100 0.56
101 0.64
102 0.7
103 0.72
104 0.76
105 0.75
106 0.71
107 0.64
108 0.58
109 0.48
110 0.41
111 0.33
112 0.24
113 0.19
114 0.19
115 0.2
116 0.19
117 0.2
118 0.21
119 0.22
120 0.27
121 0.3
122 0.31
123 0.35
124 0.39
125 0.4
126 0.4
127 0.41
128 0.37
129 0.32
130 0.27
131 0.23
132 0.23
133 0.24
134 0.25
135 0.24
136 0.3
137 0.31
138 0.35
139 0.39
140 0.35
141 0.34
142 0.34
143 0.38
144 0.33
145 0.31
146 0.25
147 0.21
148 0.18
149 0.16
150 0.14
151 0.09
152 0.08
153 0.08
154 0.1
155 0.09
156 0.12
157 0.13
158 0.13
159 0.13
160 0.16
161 0.16
162 0.14
163 0.13
164 0.12
165 0.11
166 0.11
167 0.11
168 0.07
169 0.07
170 0.07
171 0.06
172 0.06
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.02
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.04
201 0.03
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.08
214 0.08
215 0.13
216 0.16
217 0.18
218 0.21
219 0.24
220 0.27
221 0.28
222 0.28
223 0.23
224 0.23
225 0.26
226 0.23
227 0.2
228 0.21
229 0.21
230 0.25
231 0.25
232 0.23
233 0.2
234 0.22
235 0.25
236 0.24
237 0.2
238 0.19
239 0.2
240 0.2
241 0.22
242 0.21
243 0.19
244 0.17
245 0.18
246 0.15
247 0.18
248 0.21
249 0.24
250 0.29
251 0.35
252 0.43
253 0.51
254 0.61
255 0.69
256 0.75
257 0.76
258 0.8
259 0.84
260 0.8
261 0.8
262 0.74
263 0.67
264 0.58
265 0.52
266 0.42
267 0.32
268 0.25
269 0.16
270 0.12
271 0.08
272 0.06
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.05
279 0.04
280 0.04
281 0.04
282 0.05
283 0.08
284 0.13
285 0.21
286 0.26
287 0.35
288 0.44
289 0.55
290 0.66
291 0.72
292 0.78
293 0.81
294 0.86
295 0.88
296 0.89
297 0.83
298 0.74
299 0.66
300 0.56
301 0.46
302 0.35
303 0.25
304 0.15
305 0.11
306 0.1
307 0.1
308 0.1
309 0.11
310 0.12
311 0.12
312 0.14
313 0.13
314 0.13
315 0.14
316 0.14
317 0.14
318 0.14
319 0.16
320 0.14
321 0.15
322 0.14
323 0.14
324 0.13
325 0.12
326 0.19
327 0.17
328 0.23
329 0.25
330 0.24
331 0.24
332 0.23
333 0.23
334 0.17
335 0.18
336 0.14
337 0.13
338 0.13
339 0.14
340 0.16
341 0.17
342 0.17
343 0.22
344 0.25
345 0.31
346 0.34
347 0.36
348 0.37
349 0.4
350 0.4
351 0.38
352 0.4
353 0.34
354 0.36
355 0.35
356 0.31
357 0.27
358 0.27
359 0.24
360 0.17
361 0.15
362 0.1
363 0.09
364 0.09
365 0.09
366 0.08
367 0.12
368 0.15
369 0.23
370 0.29
371 0.3
372 0.36
373 0.45
374 0.53
375 0.55
376 0.57
377 0.53
378 0.49
379 0.52
380 0.49
381 0.46
382 0.38
383 0.31
384 0.26
385 0.25
386 0.26
387 0.23
388 0.21
389 0.15
390 0.17
391 0.19
392 0.25