Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SJ10

Protein Details
Accession A0A4V3SJ10    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-123KFESARVTEKQKKKQIHFPKRKYALKAHydrophilic
NLS Segment(s)
PositionSequence
84-123RPKQTRAIRRRLNKFESARVTEKQKKKQIHFPKRKYALKA
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKAAQLWTKNKEDLTKQLDELKNELVNLRVQKVVGGNSAKLTKIHDVRKSIARTLTILNAKQRQQLRILYKNKKYLPLDLRPKQTRAIRRRLNKFESARVTEKQKKKQIHFPKRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.46
4 0.47
5 0.44
6 0.41
7 0.47
8 0.48
9 0.44
10 0.42
11 0.37
12 0.32
13 0.29
14 0.28
15 0.2
16 0.21
17 0.21
18 0.2
19 0.17
20 0.16
21 0.17
22 0.18
23 0.18
24 0.18
25 0.18
26 0.16
27 0.18
28 0.19
29 0.18
30 0.17
31 0.18
32 0.19
33 0.24
34 0.3
35 0.33
36 0.35
37 0.38
38 0.44
39 0.44
40 0.41
41 0.36
42 0.3
43 0.27
44 0.24
45 0.26
46 0.22
47 0.21
48 0.23
49 0.26
50 0.26
51 0.3
52 0.32
53 0.28
54 0.29
55 0.34
56 0.37
57 0.42
58 0.5
59 0.54
60 0.57
61 0.64
62 0.62
63 0.63
64 0.58
65 0.57
66 0.55
67 0.56
68 0.6
69 0.59
70 0.66
71 0.62
72 0.62
73 0.61
74 0.61
75 0.61
76 0.59
77 0.64
78 0.63
79 0.69
80 0.78
81 0.8
82 0.79
83 0.78
84 0.74
85 0.72
86 0.7
87 0.67
88 0.61
89 0.57
90 0.6
91 0.61
92 0.66
93 0.67
94 0.68
95 0.72
96 0.74
97 0.8
98 0.82
99 0.84
100 0.86
101 0.85
102 0.87
103 0.88