FuNGI

A0A4S2N3Y7

Protein Details

Accession

A0A4S2N3Y7

Localization Confidence

High

Confidence Score

20.2

NoLS Segment(s)

Position	Sequence	Protein Nature
188-212	EEDRGETRERQRRRPRRSEAADDRD	Basic
252-296	VREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFP	Basic

NLS Segment(s)

Position	Sequence
196-204	ERQRRRPRR
248-306	ERRGVREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFPLDSAPRKEKK
485-495	AGRRRGGGRRR

Subcellular Location(s)

nucl 23, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR019416 NCBP3
Gene Ontology	GO:0003729 F:mRNA binding GO:0000340 F:RNA 7-methylguanosine cap binding
Pfam	View protein in Pfam PF10309 NCBP3

Amino Acid Sequences

MASELSNPFSANPPAPTAVPAPRYDDDDDILMDFEDETEQLATSGTTAPTPVGEAMALDPLNPPAEASPDDAVQPEKVYLYGVDNLNTAAVKSYASEHFPGHEARLEWIDDSSCCLVYATPELANAALTALTLPSHSPSILPPLVLRPAKSSPTYTPDASLQVRIARPTDRKERGARERSRYYLFHPEEDRGETRERQRRRPRRSEAADDRDYERRYYDAREHDRRRDRGEAAGYTDDMYDDDAGTRERRGVREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFPLDSAPRKEKKDLIPETKRAGMAAMDTILTAQPPSTTTVRNDNDLFAARMREKRELFPQESAPTQKRELFPQEPVPQQRKELFPQDSQRKELFPPPPRELFPSSSSTPSTSTFNPFSSTPSTSLASRITAPAPAAKSLADRINLSNPGSSNSNGDGGLQIKGAAAKMALANNDVFAQKMLASKGEGLAGAGRRRGGGRRRAEEMF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.26
3	0.28
4	0.28
5	0.31
6	0.32
7	0.31
8	0.34
9	0.34
10	0.38
11	0.38
12	0.36
13	0.31
14	0.28
15	0.27
16	0.2
17	0.19
18	0.14
19	0.12
20	0.09
21	0.08
22	0.07
23	0.07
24	0.07
25	0.07
26	0.07
27	0.07
28	0.07
29	0.07
30	0.07
31	0.1
32	0.09
33	0.09
34	0.09
35	0.09
36	0.09
37	0.11
38	0.1
39	0.08
40	0.08
41	0.08
42	0.08
43	0.12
44	0.11
45	0.1
46	0.11
47	0.11
48	0.13
49	0.12
50	0.11
51	0.08
52	0.12
53	0.13
54	0.15
55	0.16
56	0.15
57	0.16
58	0.17
59	0.18
60	0.15
61	0.15
62	0.12
63	0.11
64	0.11
65	0.11
66	0.11
67	0.12
68	0.17
69	0.17
70	0.17
71	0.17
72	0.17
73	0.17
74	0.16
75	0.13
76	0.09
77	0.08
78	0.07
79	0.07
80	0.11
81	0.13
82	0.16
83	0.18
84	0.17
85	0.18
86	0.21
87	0.21
88	0.19
89	0.2
90	0.18
91	0.18
92	0.2
93	0.19
94	0.17
95	0.17
96	0.16
97	0.12
98	0.15
99	0.15
100	0.12
101	0.12
102	0.12
103	0.11
104	0.11
105	0.14
106	0.13
107	0.12
108	0.11
109	0.12
110	0.11
111	0.11
112	0.1
113	0.07
114	0.05
115	0.04
116	0.04
117	0.04
118	0.04
119	0.04
120	0.05
121	0.06
122	0.07
123	0.07
124	0.08
125	0.09
126	0.15
127	0.16
128	0.15
129	0.15
130	0.17
131	0.24
132	0.25
133	0.24
134	0.22
135	0.25
136	0.29
137	0.3
138	0.31
139	0.27
140	0.31
141	0.35
142	0.3
143	0.29
144	0.27
145	0.29
146	0.27
147	0.25
148	0.21
149	0.21
150	0.21
151	0.21
152	0.21
153	0.22
154	0.26
155	0.31
156	0.4
157	0.41
158	0.46
159	0.51
160	0.59
161	0.63
162	0.69
163	0.7
164	0.68
165	0.68
166	0.67
167	0.65
168	0.57
169	0.51
170	0.52
171	0.46
172	0.42
173	0.38
174	0.36
175	0.33
176	0.36
177	0.32
178	0.25
179	0.26
180	0.26
181	0.33
182	0.4
183	0.43
184	0.5
185	0.6
186	0.68
187	0.75
188	0.81
189	0.8
190	0.82
191	0.84
192	0.83
193	0.82
194	0.8
195	0.72
196	0.64
197	0.59
198	0.54
199	0.48
200	0.38
201	0.29
202	0.22
203	0.21
204	0.22
205	0.25
206	0.29
207	0.37
208	0.46
209	0.51
210	0.59
211	0.66
212	0.66
213	0.65
214	0.6
215	0.53
216	0.48
217	0.46
218	0.37
219	0.31
220	0.28
221	0.24
222	0.19
223	0.17
224	0.12
225	0.09
226	0.08
227	0.05
228	0.05
229	0.05
230	0.05
231	0.06
232	0.06
233	0.07
234	0.1
235	0.12
236	0.13
237	0.16
238	0.21
239	0.27
240	0.36
241	0.43
242	0.48
243	0.54
244	0.56
245	0.59
246	0.64
247	0.66
248	0.65
249	0.7
250	0.72
251	0.76
252	0.84
253	0.87
254	0.86
255	0.88
256	0.87
257	0.81
258	0.79
259	0.75
260	0.73
261	0.7
262	0.65
263	0.59
264	0.57
265	0.58
266	0.52
267	0.5
268	0.51
269	0.55
270	0.61
271	0.67
272	0.7
273	0.74
274	0.84
275	0.86
276	0.86
277	0.82
278	0.77
279	0.74
280	0.72
281	0.63
282	0.53
283	0.47
284	0.41
285	0.4
286	0.36
287	0.34
288	0.34
289	0.34
290	0.36
291	0.4
292	0.44
293	0.48
294	0.54
295	0.58
296	0.6
297	0.61
298	0.61
299	0.58
300	0.51
301	0.41
302	0.33
303	0.23
304	0.16
305	0.12
306	0.09
307	0.06
308	0.06
309	0.06
310	0.06
311	0.05
312	0.05
313	0.04
314	0.04
315	0.05
316	0.09
317	0.11
318	0.13
319	0.15
320	0.25
321	0.26
322	0.3
323	0.29
324	0.27
325	0.27
326	0.26
327	0.25
328	0.16
329	0.19
330	0.18
331	0.22
332	0.25
333	0.3
334	0.31
335	0.33
336	0.42
337	0.46
338	0.46
339	0.45
340	0.45
341	0.41
342	0.42
343	0.44
344	0.39
345	0.34
346	0.34
347	0.36
348	0.34
349	0.37
350	0.42
351	0.39
352	0.4
353	0.45
354	0.48
355	0.5
356	0.56
357	0.56
358	0.49
359	0.51
360	0.51
361	0.47
362	0.46
363	0.48
364	0.45
365	0.46
366	0.54
367	0.59
368	0.58
369	0.59
370	0.55
371	0.49
372	0.47
373	0.49
374	0.48
375	0.48
376	0.52
377	0.52
378	0.55
379	0.55
380	0.57
381	0.54
382	0.49
383	0.44
384	0.41
385	0.38
386	0.37
387	0.36
388	0.32
389	0.3
390	0.27
391	0.27
392	0.23
393	0.27
394	0.27
395	0.26
396	0.27
397	0.25
398	0.28
399	0.29
400	0.29
401	0.25
402	0.26
403	0.27
404	0.24
405	0.27
406	0.24
407	0.21
408	0.2
409	0.2
410	0.17
411	0.17
412	0.18
413	0.2
414	0.2
415	0.2
416	0.19
417	0.17
418	0.19
419	0.21
420	0.25
421	0.22
422	0.22
423	0.24
424	0.3
425	0.32
426	0.31
427	0.3
428	0.26
429	0.28
430	0.28
431	0.26
432	0.23
433	0.22
434	0.22
435	0.19
436	0.19
437	0.18
438	0.16
439	0.16
440	0.13
441	0.12
442	0.11
443	0.12
444	0.11
445	0.09
446	0.08
447	0.09
448	0.11
449	0.14
450	0.14
451	0.15
452	0.15
453	0.15
454	0.17
455	0.15
456	0.13
457	0.11
458	0.11
459	0.11
460	0.14
461	0.15
462	0.14
463	0.16
464	0.17
465	0.17
466	0.18
467	0.16
468	0.13
469	0.17
470	0.21
471	0.23
472	0.24
473	0.23
474	0.24
475	0.28
476	0.36
477	0.4
478	0.44
479	0.51
480	0.55

A0A4S2N3Y7

3D AlphaFold-predicted Structure Viewer