Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N3Y7

Protein Details
Accession A0A4S2N3Y7    Localization Confidence High Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
188-212EEDRGETRERQRRRPRRSEAADDRDBasic
252-296VREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFPBasic
NLS Segment(s)
PositionSequence
196-204ERQRRRPRR
248-306ERRGVREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFPLDSAPRKEKK
485-495AGRRRGGGRRR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MASELSNPFSANPPAPTAVPAPRYDDDDDILMDFEDETEQLATSGTTAPTPVGEAMALDPLNPPAEASPDDAVQPEKVYLYGVDNLNTAAVKSYASEHFPGHEARLEWIDDSSCCLVYATPELANAALTALTLPSHSPSILPPLVLRPAKSSPTYTPDASLQVRIARPTDRKERGARERSRYYLFHPEEDRGETRERQRRRPRRSEAADDRDYERRYYDAREHDRRRDRGEAAGYTDDMYDDDAGTRERRGVREGRSRSRSRTRRDRRSRSPGVYNTRDRDRSRSPRRNRGKELFPLDSAPRKEKKDLIPETKRAGMAAMDTILTAQPPSTTTVRNDNDLFAARMREKRELFPQESAPTQKRELFPQEPVPQQRKELFPQDSQRKELFPPPPRELFPSSSSTPSTSTFNPFSSTPSTSLASRITAPAPAAKSLADRINLSNPGSSNSNGDGGLQIKGAAAKMALANNDVFAQKMLASKGEGLAGAGRRRGGGRRRAEEMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.28
5 0.31
6 0.32
7 0.31
8 0.34
9 0.34
10 0.38
11 0.38
12 0.36
13 0.31
14 0.28
15 0.27
16 0.2
17 0.19
18 0.14
19 0.12
20 0.09
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.1
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.1
39 0.08
40 0.08
41 0.08
42 0.08
43 0.12
44 0.11
45 0.1
46 0.11
47 0.11
48 0.13
49 0.12
50 0.11
51 0.08
52 0.12
53 0.13
54 0.15
55 0.16
56 0.15
57 0.16
58 0.17
59 0.18
60 0.15
61 0.15
62 0.12
63 0.11
64 0.11
65 0.11
66 0.11
67 0.12
68 0.17
69 0.17
70 0.17
71 0.17
72 0.17
73 0.17
74 0.16
75 0.13
76 0.09
77 0.08
78 0.07
79 0.07
80 0.11
81 0.13
82 0.16
83 0.18
84 0.17
85 0.18
86 0.21
87 0.21
88 0.19
89 0.2
90 0.18
91 0.18
92 0.2
93 0.19
94 0.17
95 0.17
96 0.16
97 0.12
98 0.15
99 0.15
100 0.12
101 0.12
102 0.12
103 0.11
104 0.11
105 0.14
106 0.13
107 0.12
108 0.11
109 0.12
110 0.11
111 0.11
112 0.1
113 0.07
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.09
126 0.15
127 0.16
128 0.15
129 0.15
130 0.17
131 0.24
132 0.25
133 0.24
134 0.22
135 0.25
136 0.29
137 0.3
138 0.31
139 0.27
140 0.31
141 0.35
142 0.3
143 0.29
144 0.27
145 0.29
146 0.27
147 0.25
148 0.21
149 0.21
150 0.21
151 0.21
152 0.21
153 0.22
154 0.26
155 0.31
156 0.4
157 0.41
158 0.46
159 0.51
160 0.59
161 0.63
162 0.69
163 0.7
164 0.68
165 0.68
166 0.67
167 0.65
168 0.57
169 0.51
170 0.52
171 0.46
172 0.42
173 0.38
174 0.36
175 0.33
176 0.36
177 0.32
178 0.25
179 0.26
180 0.26
181 0.33
182 0.4
183 0.43
184 0.5
185 0.6
186 0.68
187 0.75
188 0.81
189 0.8
190 0.82
191 0.84
192 0.83
193 0.82
194 0.8
195 0.72
196 0.64
197 0.59
198 0.54
199 0.48
200 0.38
201 0.29
202 0.22
203 0.21
204 0.22
205 0.25
206 0.29
207 0.37
208 0.46
209 0.51
210 0.59
211 0.66
212 0.66
213 0.65
214 0.6
215 0.53
216 0.48
217 0.46
218 0.37
219 0.31
220 0.28
221 0.24
222 0.19
223 0.17
224 0.12
225 0.09
226 0.08
227 0.05
228 0.05
229 0.05
230 0.05
231 0.06
232 0.06
233 0.07
234 0.1
235 0.12
236 0.13
237 0.16
238 0.21
239 0.27
240 0.36
241 0.43
242 0.48
243 0.54
244 0.56
245 0.59
246 0.64
247 0.66
248 0.65
249 0.7
250 0.72
251 0.76
252 0.84
253 0.87
254 0.86
255 0.88
256 0.87
257 0.81
258 0.79
259 0.75
260 0.73
261 0.7
262 0.65
263 0.59
264 0.57
265 0.58
266 0.52
267 0.5
268 0.51
269 0.55
270 0.61
271 0.67
272 0.7
273 0.74
274 0.84
275 0.86
276 0.86
277 0.82
278 0.77
279 0.74
280 0.72
281 0.63
282 0.53
283 0.47
284 0.41
285 0.4
286 0.36
287 0.34
288 0.34
289 0.34
290 0.36
291 0.4
292 0.44
293 0.48
294 0.54
295 0.58
296 0.6
297 0.61
298 0.61
299 0.58
300 0.51
301 0.41
302 0.33
303 0.23
304 0.16
305 0.12
306 0.09
307 0.06
308 0.06
309 0.06
310 0.06
311 0.05
312 0.05
313 0.04
314 0.04
315 0.05
316 0.09
317 0.11
318 0.13
319 0.15
320 0.25
321 0.26
322 0.3
323 0.29
324 0.27
325 0.27
326 0.26
327 0.25
328 0.16
329 0.19
330 0.18
331 0.22
332 0.25
333 0.3
334 0.31
335 0.33
336 0.42
337 0.46
338 0.46
339 0.45
340 0.45
341 0.41
342 0.42
343 0.44
344 0.39
345 0.34
346 0.34
347 0.36
348 0.34
349 0.37
350 0.42
351 0.39
352 0.4
353 0.45
354 0.48
355 0.5
356 0.56
357 0.56
358 0.49
359 0.51
360 0.51
361 0.47
362 0.46
363 0.48
364 0.45
365 0.46
366 0.54
367 0.59
368 0.58
369 0.59
370 0.55
371 0.49
372 0.47
373 0.49
374 0.48
375 0.48
376 0.52
377 0.52
378 0.55
379 0.55
380 0.57
381 0.54
382 0.49
383 0.44
384 0.41
385 0.38
386 0.37
387 0.36
388 0.32
389 0.3
390 0.27
391 0.27
392 0.23
393 0.27
394 0.27
395 0.26
396 0.27
397 0.25
398 0.28
399 0.29
400 0.29
401 0.25
402 0.26
403 0.27
404 0.24
405 0.27
406 0.24
407 0.21
408 0.2
409 0.2
410 0.17
411 0.17
412 0.18
413 0.2
414 0.2
415 0.2
416 0.19
417 0.17
418 0.19
419 0.21
420 0.25
421 0.22
422 0.22
423 0.24
424 0.3
425 0.32
426 0.31
427 0.3
428 0.26
429 0.28
430 0.28
431 0.26
432 0.23
433 0.22
434 0.22
435 0.19
436 0.19
437 0.18
438 0.16
439 0.16
440 0.13
441 0.12
442 0.11
443 0.12
444 0.11
445 0.09
446 0.08
447 0.09
448 0.11
449 0.14
450 0.14
451 0.15
452 0.15
453 0.15
454 0.17
455 0.15
456 0.13
457 0.11
458 0.11
459 0.11
460 0.14
461 0.15
462 0.14
463 0.16
464 0.17
465 0.17
466 0.18
467 0.16
468 0.13
469 0.17
470 0.21
471 0.23
472 0.24
473 0.23
474 0.24
475 0.28
476 0.36
477 0.4
478 0.44
479 0.51
480 0.55