Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MKG5

Protein Details
Accession A0A4S2MKG5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-27CAVESPYHLRQHRRKPKPISQREIGAHydrophilic
NLS Segment(s)
PositionSequence
14-18RRKPK
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MCAVESPYHLRQHRRKPKPISQREIGAARPHDLAHAPGAKPPWEWNRSSGAINLWSYGAWVQHNLLVSTARFWPRCHSHVATLLNAPLALQRSDQLTFVAMVAGGDQHHHDRIRDHNRSRACKHSITVGPNAATHGRLVGYRSLVVGIRAVPPLFLSLRGGGGGVDGMGCNAVVMSRVWGGHGVSLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.89
5 0.9
6 0.91
7 0.88
8 0.83
9 0.78
10 0.74
11 0.67
12 0.6
13 0.55
14 0.46
15 0.4
16 0.35
17 0.29
18 0.25
19 0.23
20 0.21
21 0.19
22 0.22
23 0.2
24 0.22
25 0.24
26 0.23
27 0.23
28 0.29
29 0.32
30 0.32
31 0.33
32 0.33
33 0.37
34 0.38
35 0.38
36 0.33
37 0.26
38 0.25
39 0.24
40 0.22
41 0.16
42 0.13
43 0.13
44 0.12
45 0.11
46 0.08
47 0.08
48 0.08
49 0.1
50 0.11
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.13
57 0.17
58 0.17
59 0.18
60 0.24
61 0.28
62 0.3
63 0.34
64 0.32
65 0.31
66 0.36
67 0.37
68 0.32
69 0.27
70 0.25
71 0.19
72 0.17
73 0.14
74 0.09
75 0.08
76 0.07
77 0.07
78 0.07
79 0.09
80 0.1
81 0.1
82 0.09
83 0.08
84 0.08
85 0.08
86 0.07
87 0.05
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04
93 0.05
94 0.06
95 0.09
96 0.1
97 0.11
98 0.13
99 0.23
100 0.32
101 0.4
102 0.42
103 0.46
104 0.53
105 0.6
106 0.62
107 0.6
108 0.55
109 0.49
110 0.46
111 0.47
112 0.45
113 0.41
114 0.41
115 0.36
116 0.32
117 0.29
118 0.3
119 0.23
120 0.18
121 0.14
122 0.11
123 0.09
124 0.09
125 0.11
126 0.11
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.12
133 0.11
134 0.1
135 0.11
136 0.12
137 0.12
138 0.11
139 0.11
140 0.13
141 0.12
142 0.12
143 0.12
144 0.11
145 0.12
146 0.12
147 0.12
148 0.09
149 0.08
150 0.07
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.07
163 0.09
164 0.09
165 0.1
166 0.12
167 0.13
168 0.13