Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N806

Protein Details
Accession A0A4S2N806    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22KKHPHQKKRSHPSVTNLKKKIRBasic
NLS Segment(s)
PositionSequence
7-9KKR
80-89KATRKLKKLK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences KKHPHQKKRSHPSVTNLKKKIRDLERLLARPNSKLTADARAENERALQAFKYELGSASKDKREQALARKYHMVRFFERQKATRKLKKLKRELDETENPTEDLRTRVHDAEVELNYTLHYPRGEKYISLFKDPGNNDKVKQKRDSIKQDIARRMEEGTLGAQTLDEGNAADDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.81
4 0.78
5 0.75
6 0.75
7 0.75
8 0.72
9 0.71
10 0.67
11 0.7
12 0.71
13 0.69
14 0.68
15 0.65
16 0.58
17 0.51
18 0.47
19 0.4
20 0.31
21 0.31
22 0.28
23 0.3
24 0.31
25 0.31
26 0.32
27 0.33
28 0.33
29 0.3
30 0.29
31 0.22
32 0.2
33 0.18
34 0.14
35 0.11
36 0.11
37 0.11
38 0.11
39 0.1
40 0.11
41 0.11
42 0.14
43 0.17
44 0.21
45 0.24
46 0.25
47 0.26
48 0.26
49 0.3
50 0.32
51 0.38
52 0.43
53 0.41
54 0.42
55 0.48
56 0.47
57 0.46
58 0.47
59 0.41
60 0.35
61 0.4
62 0.44
63 0.44
64 0.46
65 0.44
66 0.47
67 0.54
68 0.6
69 0.59
70 0.62
71 0.65
72 0.7
73 0.76
74 0.78
75 0.77
76 0.72
77 0.72
78 0.68
79 0.65
80 0.64
81 0.58
82 0.5
83 0.42
84 0.38
85 0.3
86 0.26
87 0.19
88 0.15
89 0.12
90 0.13
91 0.15
92 0.16
93 0.16
94 0.17
95 0.17
96 0.2
97 0.19
98 0.17
99 0.15
100 0.14
101 0.13
102 0.13
103 0.12
104 0.09
105 0.09
106 0.09
107 0.1
108 0.15
109 0.15
110 0.15
111 0.19
112 0.26
113 0.27
114 0.3
115 0.3
116 0.27
117 0.34
118 0.35
119 0.38
120 0.35
121 0.36
122 0.34
123 0.42
124 0.49
125 0.48
126 0.51
127 0.53
128 0.57
129 0.65
130 0.73
131 0.72
132 0.74
133 0.75
134 0.79
135 0.78
136 0.73
137 0.64
138 0.56
139 0.48
140 0.39
141 0.32
142 0.25
143 0.18
144 0.14
145 0.13
146 0.11
147 0.09
148 0.09
149 0.09
150 0.08
151 0.06
152 0.06
153 0.07