Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MWA6

Protein Details
Accession A0A4S2MWA6   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
431-450FAPAASKNKWHEKFRKGKIKHydrophilic
NLS Segment(s)
PositionSequence
438-450NKWHEKFRKGKIK
Subcellular Location(s) cyto 13, cyto_nucl 10, cysk 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MMMGVTCLEVDRNSASSGEVLEWREQRWFLAGGERVKDVEKSGDGEGRGVDALVTRHDQARLPKCNSSGALSSYSSSSSSTLIFSYPAMSAPPPSSAAADSGIPLDYLHDQSTVRLIELPPAVLSLLTSSSTPILQIKATTPPEKAPTSSSAYNAVLCTSSQTYALRQVSTSNTIFLTTPDATGQRLTATSTITSHLELFPNPNSPSALLQPHLQPYNGWEDADIRSTTMEDVVDEPVTRMSLLPELPISDGEFTEAWRASGAFEWRGKIYQPTPTVLVKALQVIFTATTAERLGIETEVGVKIEDIMKAIDDDEVPRGLIEGVIGVVCDELDTGRWKLNLERCCKVAGKAVLQAWGEAHKVAKGPSDLLYVGFMKKWKDAVPHSCKGLCKTELIEDWYTMPTPNTIRFNPSGSGSPSSTGDSTVTTSAAFAPAASKNKWHEKFRKGKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.15
5 0.15
6 0.16
7 0.17
8 0.23
9 0.25
10 0.25
11 0.28
12 0.28
13 0.26
14 0.26
15 0.25
16 0.2
17 0.26
18 0.3
19 0.31
20 0.33
21 0.33
22 0.31
23 0.3
24 0.3
25 0.24
26 0.23
27 0.2
28 0.2
29 0.22
30 0.25
31 0.24
32 0.24
33 0.22
34 0.19
35 0.17
36 0.14
37 0.11
38 0.09
39 0.1
40 0.12
41 0.14
42 0.14
43 0.17
44 0.19
45 0.23
46 0.3
47 0.39
48 0.45
49 0.48
50 0.51
51 0.5
52 0.53
53 0.51
54 0.46
55 0.39
56 0.33
57 0.32
58 0.28
59 0.27
60 0.23
61 0.22
62 0.18
63 0.16
64 0.14
65 0.12
66 0.12
67 0.12
68 0.11
69 0.11
70 0.11
71 0.1
72 0.11
73 0.1
74 0.1
75 0.1
76 0.1
77 0.12
78 0.12
79 0.14
80 0.14
81 0.14
82 0.15
83 0.14
84 0.15
85 0.14
86 0.13
87 0.11
88 0.1
89 0.1
90 0.08
91 0.08
92 0.08
93 0.09
94 0.11
95 0.11
96 0.12
97 0.12
98 0.12
99 0.16
100 0.15
101 0.13
102 0.14
103 0.13
104 0.16
105 0.17
106 0.17
107 0.13
108 0.13
109 0.12
110 0.1
111 0.1
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.07
118 0.08
119 0.09
120 0.09
121 0.09
122 0.09
123 0.1
124 0.11
125 0.18
126 0.23
127 0.24
128 0.24
129 0.26
130 0.3
131 0.31
132 0.3
133 0.26
134 0.25
135 0.29
136 0.29
137 0.27
138 0.26
139 0.25
140 0.25
141 0.22
142 0.18
143 0.13
144 0.11
145 0.13
146 0.1
147 0.1
148 0.11
149 0.11
150 0.12
151 0.19
152 0.21
153 0.18
154 0.17
155 0.19
156 0.2
157 0.24
158 0.23
159 0.17
160 0.15
161 0.16
162 0.16
163 0.14
164 0.16
165 0.12
166 0.12
167 0.12
168 0.12
169 0.12
170 0.12
171 0.12
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.09
179 0.1
180 0.1
181 0.1
182 0.1
183 0.11
184 0.11
185 0.1
186 0.12
187 0.12
188 0.15
189 0.15
190 0.15
191 0.15
192 0.14
193 0.15
194 0.16
195 0.16
196 0.13
197 0.14
198 0.15
199 0.18
200 0.18
201 0.16
202 0.13
203 0.14
204 0.19
205 0.18
206 0.16
207 0.13
208 0.14
209 0.15
210 0.17
211 0.15
212 0.09
213 0.09
214 0.09
215 0.09
216 0.07
217 0.07
218 0.05
219 0.06
220 0.06
221 0.07
222 0.06
223 0.07
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.07
230 0.07
231 0.07
232 0.07
233 0.07
234 0.08
235 0.08
236 0.08
237 0.06
238 0.06
239 0.07
240 0.07
241 0.07
242 0.09
243 0.09
244 0.08
245 0.08
246 0.08
247 0.07
248 0.1
249 0.11
250 0.12
251 0.14
252 0.15
253 0.15
254 0.16
255 0.16
256 0.18
257 0.18
258 0.21
259 0.22
260 0.22
261 0.25
262 0.25
263 0.25
264 0.22
265 0.21
266 0.14
267 0.16
268 0.14
269 0.11
270 0.11
271 0.1
272 0.1
273 0.09
274 0.1
275 0.06
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.08
282 0.07
283 0.07
284 0.06
285 0.07
286 0.07
287 0.07
288 0.06
289 0.05
290 0.06
291 0.08
292 0.08
293 0.07
294 0.07
295 0.07
296 0.07
297 0.08
298 0.08
299 0.07
300 0.08
301 0.09
302 0.09
303 0.08
304 0.08
305 0.08
306 0.07
307 0.07
308 0.06
309 0.04
310 0.04
311 0.04
312 0.04
313 0.03
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.05
320 0.08
321 0.09
322 0.12
323 0.13
324 0.14
325 0.21
326 0.28
327 0.34
328 0.37
329 0.39
330 0.38
331 0.41
332 0.41
333 0.37
334 0.37
335 0.35
336 0.32
337 0.34
338 0.34
339 0.35
340 0.34
341 0.32
342 0.25
343 0.22
344 0.2
345 0.15
346 0.14
347 0.11
348 0.13
349 0.13
350 0.17
351 0.16
352 0.17
353 0.18
354 0.2
355 0.19
356 0.17
357 0.19
358 0.17
359 0.17
360 0.17
361 0.18
362 0.17
363 0.19
364 0.22
365 0.23
366 0.28
367 0.36
368 0.45
369 0.51
370 0.54
371 0.57
372 0.58
373 0.57
374 0.54
375 0.53
376 0.44
377 0.38
378 0.36
379 0.37
380 0.37
381 0.39
382 0.36
383 0.29
384 0.3
385 0.28
386 0.26
387 0.21
388 0.18
389 0.17
390 0.19
391 0.24
392 0.28
393 0.29
394 0.34
395 0.36
396 0.39
397 0.37
398 0.36
399 0.35
400 0.33
401 0.35
402 0.3
403 0.3
404 0.28
405 0.29
406 0.26
407 0.23
408 0.2
409 0.17
410 0.18
411 0.17
412 0.16
413 0.12
414 0.12
415 0.12
416 0.13
417 0.11
418 0.09
419 0.11
420 0.17
421 0.22
422 0.23
423 0.28
424 0.35
425 0.46
426 0.54
427 0.61
428 0.64
429 0.7
430 0.79