Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MKQ1

Protein Details
Accession A0A4S2MKQ1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-121PDPPKDRWAKMKGRFKRLRYPLDBasic
NLS Segment(s)
PositionSequence
107-115AKMKGRFKR
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 6.5, mito 3, golg 3, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031352  SesA  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17107  SesA  
Amino Acid Sequences MADPLAVPAGVVGIVSFGINVLNGLITYYQDVKDQDDKIRAVNTQLRRLHQNFTDIKPRIEESKDTSPHVKRDDIESTLKECYAEMKELEKKLQAIQTPDPPKDRWAKMKGRFKRLRYPLDGKRTVQEIQDIASFRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.05
13 0.05
14 0.07
15 0.09
16 0.09
17 0.12
18 0.13
19 0.17
20 0.22
21 0.24
22 0.26
23 0.29
24 0.29
25 0.28
26 0.3
27 0.26
28 0.25
29 0.3
30 0.31
31 0.35
32 0.38
33 0.38
34 0.44
35 0.45
36 0.45
37 0.39
38 0.42
39 0.37
40 0.37
41 0.44
42 0.38
43 0.36
44 0.34
45 0.33
46 0.29
47 0.27
48 0.26
49 0.22
50 0.3
51 0.31
52 0.31
53 0.36
54 0.35
55 0.37
56 0.38
57 0.34
58 0.25
59 0.28
60 0.29
61 0.26
62 0.27
63 0.24
64 0.23
65 0.22
66 0.21
67 0.17
68 0.13
69 0.13
70 0.12
71 0.13
72 0.12
73 0.16
74 0.21
75 0.22
76 0.24
77 0.23
78 0.22
79 0.23
80 0.26
81 0.24
82 0.24
83 0.26
84 0.34
85 0.38
86 0.4
87 0.41
88 0.38
89 0.41
90 0.45
91 0.46
92 0.46
93 0.5
94 0.56
95 0.63
96 0.72
97 0.76
98 0.79
99 0.82
100 0.79
101 0.81
102 0.81
103 0.8
104 0.78
105 0.78
106 0.77
107 0.78
108 0.78
109 0.69
110 0.64
111 0.59
112 0.53
113 0.45
114 0.4
115 0.31
116 0.27
117 0.29