Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N7W8

Protein Details
Accession A0A4S2N7W8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
102-122LPKPGRRSRVTQKRPRSRTLTHydrophilic
NLS Segment(s)
PositionSequence
101-117ILPKPGRRSRVTQKRPR
Subcellular Location(s) nucl 14, mito_nucl 11.499, cyto_nucl 10.833, mito 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MATNKIAHNSSSHANPSELEQQIAQAFYDLENSVSDLKAALRPLQFSSAKEFEVGHGKKAIVIFVPVPLLSGFHKVQQRLTRELEKKFSDRHVVFLAQRRILPKPGRRSRVTQKRPRSRTLTSVHDAILSDLVFPTEIVGKRIRTKEDGHKIIKVFLDNKERAGVDYKVDTFGEVYRKLTGKHVTFEFPVVGDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.34
5 0.31
6 0.27
7 0.23
8 0.23
9 0.24
10 0.24
11 0.19
12 0.11
13 0.11
14 0.09
15 0.12
16 0.1
17 0.09
18 0.09
19 0.1
20 0.11
21 0.1
22 0.1
23 0.08
24 0.09
25 0.11
26 0.13
27 0.16
28 0.16
29 0.18
30 0.2
31 0.26
32 0.26
33 0.25
34 0.31
35 0.28
36 0.27
37 0.26
38 0.24
39 0.2
40 0.28
41 0.28
42 0.22
43 0.22
44 0.22
45 0.23
46 0.23
47 0.22
48 0.12
49 0.13
50 0.11
51 0.09
52 0.1
53 0.08
54 0.09
55 0.08
56 0.08
57 0.08
58 0.12
59 0.12
60 0.16
61 0.2
62 0.2
63 0.25
64 0.3
65 0.33
66 0.34
67 0.38
68 0.42
69 0.43
70 0.46
71 0.46
72 0.43
73 0.42
74 0.39
75 0.38
76 0.37
77 0.32
78 0.32
79 0.28
80 0.28
81 0.27
82 0.32
83 0.33
84 0.26
85 0.27
86 0.26
87 0.25
88 0.3
89 0.34
90 0.33
91 0.41
92 0.48
93 0.54
94 0.54
95 0.6
96 0.65
97 0.69
98 0.73
99 0.72
100 0.75
101 0.79
102 0.82
103 0.81
104 0.77
105 0.69
106 0.67
107 0.62
108 0.58
109 0.5
110 0.46
111 0.4
112 0.33
113 0.3
114 0.22
115 0.18
116 0.11
117 0.08
118 0.07
119 0.07
120 0.06
121 0.05
122 0.06
123 0.09
124 0.1
125 0.12
126 0.15
127 0.18
128 0.25
129 0.29
130 0.32
131 0.31
132 0.37
133 0.45
134 0.52
135 0.57
136 0.54
137 0.55
138 0.52
139 0.52
140 0.48
141 0.42
142 0.35
143 0.34
144 0.4
145 0.36
146 0.36
147 0.36
148 0.34
149 0.32
150 0.33
151 0.27
152 0.21
153 0.25
154 0.24
155 0.23
156 0.23
157 0.21
158 0.18
159 0.2
160 0.23
161 0.2
162 0.21
163 0.24
164 0.26
165 0.27
166 0.32
167 0.37
168 0.35
169 0.39
170 0.41
171 0.4
172 0.4
173 0.41
174 0.35