Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V3SIJ2

Protein Details
Accession A0A4V3SIJ2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-96CKPAPNLHRTRYRKIRKQYPQPTSYHQHydrophilic
NLS Segment(s)
PositionSequence
40-51GGKREEKRKERI
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKTPATPNNISPTTRNDDPEHQQRHCDSIGNKNGETKENGGKREEKRKERITQKRTEEPETLKTPARFACKPAPNLHRTRYRKIRKQYPQPTSYHQPPSPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.39
4 0.42
5 0.48
6 0.55
7 0.56
8 0.49
9 0.51
10 0.48
11 0.48
12 0.42
13 0.39
14 0.32
15 0.34
16 0.41
17 0.4
18 0.39
19 0.39
20 0.4
21 0.37
22 0.36
23 0.3
24 0.3
25 0.3
26 0.32
27 0.3
28 0.36
29 0.39
30 0.48
31 0.53
32 0.52
33 0.57
34 0.63
35 0.68
36 0.72
37 0.77
38 0.73
39 0.73
40 0.72
41 0.72
42 0.69
43 0.65
44 0.59
45 0.52
46 0.5
47 0.45
48 0.41
49 0.37
50 0.33
51 0.31
52 0.31
53 0.34
54 0.29
55 0.3
56 0.37
57 0.39
58 0.43
59 0.49
60 0.53
61 0.54
62 0.59
63 0.61
64 0.62
65 0.62
66 0.68
67 0.71
68 0.74
69 0.77
70 0.81
71 0.85
72 0.85
73 0.9
74 0.91
75 0.9
76 0.86
77 0.81
78 0.79
79 0.77
80 0.75
81 0.73