Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MQ25

Protein Details
Accession A0A4S2MQ25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-113RPVPPRRDRTHRSLRNMPQQNQKMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, plas 8, mito 4
Family & Domain DBs
Amino Acid Sequences MRCSVLTIITAILLSTSVVALPAGPSINDSEKRAKNIVQRDDAPVGERKAQGTSLFHQPPVTREPTLIALCQPALPHGSPAPATTATVHRPVPPRRDRTHRSLRNMPQQNQKMASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.06
10 0.06
11 0.06
12 0.07
13 0.09
14 0.14
15 0.17
16 0.2
17 0.27
18 0.3
19 0.34
20 0.35
21 0.37
22 0.39
23 0.46
24 0.48
25 0.45
26 0.44
27 0.44
28 0.43
29 0.39
30 0.35
31 0.3
32 0.25
33 0.23
34 0.22
35 0.18
36 0.17
37 0.18
38 0.17
39 0.16
40 0.17
41 0.22
42 0.22
43 0.22
44 0.22
45 0.22
46 0.23
47 0.24
48 0.24
49 0.16
50 0.16
51 0.17
52 0.19
53 0.2
54 0.17
55 0.14
56 0.12
57 0.12
58 0.12
59 0.1
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.13
69 0.11
70 0.12
71 0.12
72 0.15
73 0.17
74 0.2
75 0.21
76 0.23
77 0.31
78 0.37
79 0.46
80 0.52
81 0.58
82 0.62
83 0.71
84 0.72
85 0.74
86 0.78
87 0.77
88 0.77
89 0.79
90 0.8
91 0.81
92 0.85
93 0.82
94 0.81
95 0.79
96 0.77
97 0.71