Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MPY0

Protein Details
Accession A0A4S2MPY0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-109STPSKPTTKAPRARKVKKTAAEHydrophilic
NLS Segment(s)
PositionSequence
96-105KAPRARKVKK
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 6.5, extr 3, plas 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTSYPAEPETDLELGLIDGPTLPAYTEWDPAVLGEKPGEHHDDPPKYVEFNAGIMHPVITLPPATHLPSSSTSSPSTSSPSIPSNGSTPSKPTTKAPRARKVKKTAAESDRTLSLCTRALIAVGLCIGIGVLASKLVILAAPKEADKQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.09
5 0.05
6 0.05
7 0.05
8 0.06
9 0.05
10 0.06
11 0.05
12 0.1
13 0.12
14 0.14
15 0.14
16 0.13
17 0.13
18 0.13
19 0.16
20 0.12
21 0.11
22 0.1
23 0.1
24 0.12
25 0.14
26 0.2
27 0.17
28 0.22
29 0.3
30 0.32
31 0.33
32 0.35
33 0.33
34 0.28
35 0.27
36 0.24
37 0.17
38 0.15
39 0.14
40 0.11
41 0.11
42 0.1
43 0.1
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.06
51 0.07
52 0.09
53 0.09
54 0.09
55 0.11
56 0.14
57 0.18
58 0.17
59 0.17
60 0.17
61 0.17
62 0.18
63 0.17
64 0.17
65 0.15
66 0.15
67 0.15
68 0.16
69 0.16
70 0.16
71 0.16
72 0.14
73 0.17
74 0.18
75 0.16
76 0.18
77 0.2
78 0.21
79 0.22
80 0.26
81 0.33
82 0.41
83 0.49
84 0.56
85 0.63
86 0.71
87 0.79
88 0.83
89 0.82
90 0.81
91 0.79
92 0.77
93 0.76
94 0.72
95 0.68
96 0.61
97 0.54
98 0.48
99 0.42
100 0.36
101 0.27
102 0.22
103 0.19
104 0.17
105 0.15
106 0.12
107 0.11
108 0.11
109 0.1
110 0.09
111 0.07
112 0.06
113 0.05
114 0.05
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.05
126 0.05
127 0.07
128 0.09
129 0.11
130 0.12
131 0.15