Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N7U0

Protein Details
Accession A0A4S2N7U0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89LKYCKKFSSAKKKFSPRGKAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004978  Stanniocalcin  
Gene Ontology GO:0005576  C:extracellular region  
GO:0005179  F:hormone activity  
Pfam View protein in Pfam  
PF03298  Stanniocalcin  
Amino Acid Sequences MKFSLTALIAPLLLLPLATALSPRAPIPELEPRAAATCSKPQANTCTFYTKCLEPAFKCGKNGYPLNYGLKYCKKFSSAKKKFSPRGKAWVTKTMLCLQNKLVNDVKKPKIGCSKLRSKAFATHPECYVKSGLCVLPTSDWAKIVATVSIKELFGSVQALKATLDTVDGCMGFYKWLIKKGLIKVKNGVVSWAKGVWDTITGWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.09
10 0.09
11 0.12
12 0.12
13 0.13
14 0.18
15 0.27
16 0.29
17 0.3
18 0.3
19 0.28
20 0.3
21 0.3
22 0.26
23 0.2
24 0.23
25 0.26
26 0.29
27 0.29
28 0.3
29 0.37
30 0.39
31 0.39
32 0.34
33 0.38
34 0.36
35 0.37
36 0.38
37 0.31
38 0.32
39 0.32
40 0.34
41 0.27
42 0.35
43 0.41
44 0.39
45 0.4
46 0.38
47 0.38
48 0.4
49 0.42
50 0.37
51 0.33
52 0.33
53 0.36
54 0.36
55 0.33
56 0.32
57 0.37
58 0.36
59 0.34
60 0.33
61 0.32
62 0.38
63 0.47
64 0.53
65 0.54
66 0.61
67 0.67
68 0.74
69 0.78
70 0.8
71 0.8
72 0.72
73 0.73
74 0.7
75 0.68
76 0.62
77 0.62
78 0.55
79 0.48
80 0.46
81 0.42
82 0.42
83 0.35
84 0.32
85 0.26
86 0.28
87 0.26
88 0.28
89 0.26
90 0.22
91 0.26
92 0.32
93 0.33
94 0.32
95 0.33
96 0.34
97 0.39
98 0.42
99 0.46
100 0.45
101 0.53
102 0.57
103 0.6
104 0.58
105 0.51
106 0.54
107 0.51
108 0.54
109 0.49
110 0.43
111 0.42
112 0.43
113 0.41
114 0.35
115 0.31
116 0.21
117 0.17
118 0.17
119 0.16
120 0.13
121 0.13
122 0.12
123 0.12
124 0.14
125 0.16
126 0.13
127 0.13
128 0.12
129 0.12
130 0.12
131 0.12
132 0.11
133 0.1
134 0.11
135 0.12
136 0.13
137 0.13
138 0.12
139 0.12
140 0.09
141 0.09
142 0.11
143 0.09
144 0.1
145 0.1
146 0.1
147 0.1
148 0.1
149 0.1
150 0.07
151 0.09
152 0.07
153 0.08
154 0.09
155 0.08
156 0.09
157 0.09
158 0.09
159 0.08
160 0.09
161 0.15
162 0.17
163 0.23
164 0.25
165 0.28
166 0.35
167 0.44
168 0.54
169 0.51
170 0.52
171 0.52
172 0.56
173 0.57
174 0.5
175 0.47
176 0.4
177 0.37
178 0.36
179 0.32
180 0.26
181 0.21
182 0.22
183 0.17
184 0.15