Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MIK7

Protein Details
Accession A0A4S2MIK7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-88TKRLLVRKAKMNRRQQFRDLRNHydrophilic
NLS Segment(s)
PositionSequence
52-80KPPSKAGRPRKLDERTKRLLVRKAKMNRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF13551  HTH_29  
Amino Acid Sequences TRRTNLSEFEKGQIITLHRRGDSNRKIAEVLGRSEASVRKFVSRYNQTGDIKPPSKAGRPRKLDERTKRLLVRKAKMNRRQQFRDLRNEVCPEVSVRTVKCALREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.34
4 0.34
5 0.32
6 0.34
7 0.37
8 0.44
9 0.48
10 0.48
11 0.45
12 0.42
13 0.42
14 0.41
15 0.42
16 0.34
17 0.29
18 0.24
19 0.22
20 0.2
21 0.22
22 0.24
23 0.2
24 0.21
25 0.19
26 0.19
27 0.2
28 0.22
29 0.29
30 0.32
31 0.33
32 0.34
33 0.41
34 0.39
35 0.41
36 0.42
37 0.4
38 0.35
39 0.32
40 0.32
41 0.26
42 0.31
43 0.38
44 0.44
45 0.47
46 0.52
47 0.55
48 0.62
49 0.68
50 0.72
51 0.73
52 0.71
53 0.67
54 0.67
55 0.69
56 0.66
57 0.66
58 0.64
59 0.61
60 0.63
61 0.67
62 0.71
63 0.74
64 0.79
65 0.79
66 0.8
67 0.8
68 0.8
69 0.81
70 0.77
71 0.79
72 0.73
73 0.68
74 0.65
75 0.62
76 0.54
77 0.44
78 0.38
79 0.29
80 0.27
81 0.27
82 0.26
83 0.22
84 0.26
85 0.31
86 0.32