Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N3G8

Protein Details
Accession A0A4S2N3G8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-113PHSNHNYPHKYRRRCQPPKAKTKRTKAAIFCPHydrophilic
NLS Segment(s)
PositionSequence
101-102AK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNEMNEMKKKRKITSAQLPISSPDIPPMKAMTVSRPPSSCCCCFNPPPPPTKKKTNDNEIYNTAVSSPSTPCPPSRGIPPVPHSNHNYPHKYRRRCQPPKAKTKRTKAAIFCPPAPPVETKEKEKNHFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.73
4 0.69
5 0.64
6 0.57
7 0.52
8 0.42
9 0.31
10 0.27
11 0.23
12 0.21
13 0.21
14 0.21
15 0.19
16 0.21
17 0.21
18 0.21
19 0.28
20 0.31
21 0.33
22 0.33
23 0.34
24 0.38
25 0.43
26 0.4
27 0.35
28 0.36
29 0.39
30 0.43
31 0.48
32 0.51
33 0.49
34 0.55
35 0.6
36 0.61
37 0.61
38 0.66
39 0.65
40 0.66
41 0.7
42 0.71
43 0.7
44 0.68
45 0.67
46 0.58
47 0.53
48 0.43
49 0.35
50 0.25
51 0.17
52 0.13
53 0.1
54 0.09
55 0.08
56 0.1
57 0.11
58 0.12
59 0.15
60 0.17
61 0.18
62 0.21
63 0.26
64 0.28
65 0.32
66 0.36
67 0.42
68 0.43
69 0.46
70 0.47
71 0.46
72 0.51
73 0.54
74 0.56
75 0.53
76 0.61
77 0.66
78 0.69
79 0.71
80 0.74
81 0.77
82 0.8
83 0.85
84 0.86
85 0.86
86 0.89
87 0.93
88 0.93
89 0.91
90 0.92
91 0.91
92 0.88
93 0.86
94 0.81
95 0.79
96 0.78
97 0.74
98 0.66
99 0.6
100 0.53
101 0.46
102 0.42
103 0.36
104 0.32
105 0.36
106 0.39
107 0.43
108 0.51
109 0.58