Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N330

Protein Details
Accession A0A4S2N330    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
241-265LHELRERQRQTRRPGIQRFFPQRRDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019402  Frag1/DRAM/Sfk1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10277  Frag1  
Amino Acid Sequences MDNLAPPEPDLPHHRHHIPYYVLPLISAAVWIGTLWAMMIVWLAEGQPFYASMSETQSIAYISDVGADILRPLFITGCAITGIFFFLSLCATRSNHDLLRRKERVLDWASIISALVGAVSLIMLAVMDTLRHPDWHRGWLLFFMLGVVLSALFTTIEYRFLGKTFRQTKIIYLSYRFKQFIVIVEVALSISFGACMYKKKHNAGAIIEWLIAFLFTFYVLSFFFDLRPRASTKGIMTPEELHELRERQRQTRRPGIQRFFPQRRDVDPGQGGTVNGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.47
4 0.5
5 0.48
6 0.47
7 0.47
8 0.43
9 0.38
10 0.33
11 0.3
12 0.23
13 0.18
14 0.14
15 0.08
16 0.05
17 0.05
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.04
24 0.03
25 0.03
26 0.04
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.12
41 0.13
42 0.12
43 0.12
44 0.12
45 0.12
46 0.11
47 0.1
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.07
77 0.09
78 0.09
79 0.11
80 0.13
81 0.17
82 0.19
83 0.27
84 0.35
85 0.38
86 0.48
87 0.5
88 0.48
89 0.5
90 0.47
91 0.47
92 0.42
93 0.37
94 0.29
95 0.26
96 0.25
97 0.2
98 0.19
99 0.11
100 0.07
101 0.05
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.01
109 0.01
110 0.01
111 0.01
112 0.02
113 0.02
114 0.02
115 0.02
116 0.05
117 0.05
118 0.07
119 0.09
120 0.15
121 0.16
122 0.2
123 0.21
124 0.19
125 0.2
126 0.19
127 0.18
128 0.12
129 0.1
130 0.06
131 0.05
132 0.04
133 0.04
134 0.03
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.04
142 0.04
143 0.06
144 0.06
145 0.08
146 0.08
147 0.09
148 0.12
149 0.11
150 0.2
151 0.25
152 0.27
153 0.31
154 0.31
155 0.33
156 0.37
157 0.4
158 0.33
159 0.32
160 0.35
161 0.35
162 0.39
163 0.37
164 0.3
165 0.28
166 0.27
167 0.26
168 0.25
169 0.22
170 0.17
171 0.16
172 0.16
173 0.13
174 0.12
175 0.09
176 0.03
177 0.03
178 0.03
179 0.03
180 0.04
181 0.05
182 0.1
183 0.15
184 0.23
185 0.29
186 0.33
187 0.39
188 0.42
189 0.45
190 0.44
191 0.44
192 0.38
193 0.33
194 0.29
195 0.23
196 0.19
197 0.15
198 0.11
199 0.07
200 0.04
201 0.03
202 0.03
203 0.04
204 0.04
205 0.05
206 0.05
207 0.07
208 0.08
209 0.09
210 0.11
211 0.15
212 0.17
213 0.17
214 0.21
215 0.22
216 0.24
217 0.26
218 0.28
219 0.27
220 0.33
221 0.34
222 0.33
223 0.33
224 0.32
225 0.32
226 0.35
227 0.32
228 0.26
229 0.28
230 0.3
231 0.34
232 0.39
233 0.41
234 0.43
235 0.53
236 0.6
237 0.64
238 0.71
239 0.75
240 0.78
241 0.84
242 0.83
243 0.81
244 0.83
245 0.85
246 0.83
247 0.8
248 0.77
249 0.71
250 0.69
251 0.68
252 0.6
253 0.58
254 0.54
255 0.49
256 0.44
257 0.41
258 0.36