Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MST9

Protein Details
Accession A0A4S2MST9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-64GEWLTLKNKKAKKKKNLQKHRTFPSLHydrophilic
NLS Segment(s)
PositionSequence
45-57KNKKAKKKKNLQK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MPHPLLPLHQIITNTSPSLRLNMPFTELYSIPRPRPHDGEWLTLKNKKAKKKKNLQKHRTFPSLYQASMQLPTIPTISATTATPTTIPTPTPSPSPSTSRVLYESSGYTTNPRSASYSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.2
4 0.18
5 0.21
6 0.2
7 0.2
8 0.21
9 0.2
10 0.24
11 0.22
12 0.22
13 0.22
14 0.2
15 0.22
16 0.26
17 0.29
18 0.28
19 0.33
20 0.36
21 0.37
22 0.42
23 0.41
24 0.44
25 0.42
26 0.46
27 0.46
28 0.46
29 0.45
30 0.44
31 0.44
32 0.42
33 0.45
34 0.48
35 0.54
36 0.6
37 0.67
38 0.74
39 0.8
40 0.84
41 0.9
42 0.9
43 0.9
44 0.89
45 0.84
46 0.79
47 0.71
48 0.6
49 0.58
50 0.49
51 0.39
52 0.31
53 0.26
54 0.21
55 0.2
56 0.19
57 0.11
58 0.09
59 0.1
60 0.1
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.09
71 0.1
72 0.12
73 0.12
74 0.12
75 0.13
76 0.16
77 0.17
78 0.21
79 0.21
80 0.24
81 0.27
82 0.31
83 0.33
84 0.34
85 0.34
86 0.34
87 0.35
88 0.32
89 0.29
90 0.26
91 0.23
92 0.21
93 0.21
94 0.19
95 0.21
96 0.22
97 0.26
98 0.25
99 0.25