Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N729

Protein Details
Accession A0A4S2N729    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-55TKEITPTLRKHRRHPRLRHPAKTETBasic
NLS Segment(s)
PositionSequence
39-55RKHRRHPRLRHPAKTET
Subcellular Location(s) nucl 11, mito 9, cyto 3, extr 3
Family & Domain DBs
Amino Acid Sequences MSLHFVIIPFDHIIPVSYCRCTHITLPHRTTKEITPTLRKHRRHPRLRHPAKTETPPPRPPFSPSPSPHLHNPKYSLPPYHLNPPKKTPQHSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.17
4 0.18
5 0.18
6 0.21
7 0.23
8 0.24
9 0.26
10 0.32
11 0.38
12 0.45
13 0.5
14 0.54
15 0.54
16 0.54
17 0.52
18 0.46
19 0.46
20 0.42
21 0.41
22 0.42
23 0.47
24 0.56
25 0.63
26 0.62
27 0.64
28 0.69
29 0.76
30 0.77
31 0.8
32 0.81
33 0.83
34 0.88
35 0.87
36 0.82
37 0.79
38 0.74
39 0.7
40 0.68
41 0.65
42 0.63
43 0.63
44 0.61
45 0.58
46 0.54
47 0.54
48 0.52
49 0.5
50 0.52
51 0.47
52 0.49
53 0.49
54 0.52
55 0.54
56 0.57
57 0.54
58 0.5
59 0.52
60 0.52
61 0.55
62 0.55
63 0.5
64 0.45
65 0.48
66 0.47
67 0.53
68 0.55
69 0.55
70 0.58
71 0.62
72 0.68
73 0.69