Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DK99

Protein Details
Accession A5DK99    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCLNCHydrophilic
82-114RIVRVRSRTDRRVRTPPQRKRFNTDRKVNPADAHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
92-103RRVRTPPQRKRF
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgu:PGUG_03700  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCLNCARCVPKDKAIKRVTIRNMVEAAAVRDLSEASVYSEYAVPKLYNKLHYCVSCAIHARIVRVRSRTDRRVRTPPQRKRFNTDRKVNPADAAKKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.77
9 0.69
10 0.67
11 0.61
12 0.61
13 0.6
14 0.55
15 0.53
16 0.54
17 0.56
18 0.58
19 0.64
20 0.57
21 0.6
22 0.59
23 0.59
24 0.57
25 0.61
26 0.58
27 0.57
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.24
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.13
54 0.15
55 0.2
56 0.22
57 0.24
58 0.28
59 0.28
60 0.3
61 0.29
62 0.28
63 0.24
64 0.25
65 0.23
66 0.23
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.6
78 0.65
79 0.68
80 0.76
81 0.8
82 0.82
83 0.84
84 0.85
85 0.86
86 0.87
87 0.85
88 0.84
89 0.85
90 0.85
91 0.84
92 0.84
93 0.83
94 0.82
95 0.83
96 0.75
97 0.7
98 0.67
99 0.63