Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MQF6

Protein Details
Accession A0A4S2MQF6   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MYKPTEPPKPKPKKKQKKTPKKTPTLIIPLHydrophilic
NLS Segment(s)
PositionSequence
7-22PPKPKPKKKQKKTPKK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MYKPTEPPKPKPKKKQKKTPKKTPTLIIPLYHRPHPPRASIPPAVFSSISTHSHSRSSKYLVNASCYPLCSSASALSPFLCPLPSPSLLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.96
3 0.96
4 0.96
5 0.96
6 0.96
7 0.96
8 0.94
9 0.89
10 0.84
11 0.81
12 0.78
13 0.7
14 0.61
15 0.55
16 0.53
17 0.51
18 0.48
19 0.44
20 0.39
21 0.44
22 0.44
23 0.43
24 0.41
25 0.43
26 0.45
27 0.44
28 0.41
29 0.36
30 0.34
31 0.31
32 0.25
33 0.2
34 0.17
35 0.16
36 0.18
37 0.18
38 0.18
39 0.18
40 0.24
41 0.25
42 0.25
43 0.25
44 0.27
45 0.28
46 0.3
47 0.36
48 0.31
49 0.36
50 0.34
51 0.36
52 0.33
53 0.3
54 0.28
55 0.23
56 0.22
57 0.17
58 0.18
59 0.16
60 0.18
61 0.18
62 0.17
63 0.17
64 0.17
65 0.17
66 0.15
67 0.14
68 0.11
69 0.13
70 0.18