Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V3SI05

Protein Details
Accession A0A4V3SI05    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-43SHPRTVVSPVLRRRRRRRRRRSSHPPASVARBasic
87-112VSKSLCRIPRHYKQRCNKQSPSLHPSHydrophilic
NLS Segment(s)
PositionSequence
24-36RRRRRRRRRRSSH
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MSWPSSSPSAPSSHPRTVVSPVLRRRRRRRRRRSSHPPASVARHTHGCKADMRWASFSSVSHCSICPQLGRAPVKLPQDHSSSSSAVSKSLCRIPRHYKQRCNKQSPSLHPSIYPSRTTTSDPCFLWTFMLTHPSSVPSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.41
4 0.43
5 0.47
6 0.45
7 0.46
8 0.51
9 0.59
10 0.65
11 0.73
12 0.79
13 0.83
14 0.88
15 0.9
16 0.92
17 0.93
18 0.95
19 0.96
20 0.96
21 0.96
22 0.96
23 0.91
24 0.85
25 0.79
26 0.74
27 0.68
28 0.6
29 0.52
30 0.48
31 0.42
32 0.42
33 0.39
34 0.35
35 0.32
36 0.32
37 0.36
38 0.33
39 0.34
40 0.3
41 0.29
42 0.29
43 0.27
44 0.24
45 0.2
46 0.19
47 0.19
48 0.17
49 0.16
50 0.16
51 0.16
52 0.17
53 0.13
54 0.12
55 0.13
56 0.18
57 0.2
58 0.19
59 0.2
60 0.24
61 0.28
62 0.27
63 0.28
64 0.25
65 0.26
66 0.27
67 0.27
68 0.25
69 0.21
70 0.21
71 0.21
72 0.18
73 0.16
74 0.16
75 0.14
76 0.15
77 0.21
78 0.26
79 0.26
80 0.33
81 0.41
82 0.5
83 0.6
84 0.67
85 0.71
86 0.75
87 0.84
88 0.87
89 0.87
90 0.83
91 0.82
92 0.81
93 0.8
94 0.78
95 0.71
96 0.62
97 0.53
98 0.53
99 0.51
100 0.45
101 0.39
102 0.33
103 0.32
104 0.34
105 0.37
106 0.37
107 0.35
108 0.37
109 0.35
110 0.37
111 0.36
112 0.33
113 0.31
114 0.26
115 0.22
116 0.18
117 0.25
118 0.21
119 0.2
120 0.2
121 0.23