Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MV81

Protein Details
Accession A0A4S2MV81    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-65DLHSVKVRPTRPRPPTRPRDILLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007653  SPC3  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF04573  SPC22  
Amino Acid Sequences MLHSAPSRARYTLEFFTTITILLSIFTTLSTLLYPTSPTASLDLHSVKVRPTRPRPPTRPRDILLLTFDLTLDARPLFTWNTKQVFTYLSITYASSPSSNYTDNELIFWDMILPDIGSAKLELEGEEVRYKVSDISGSFSERGASVRLGWNVQPYVGALRWGSVELDLQGGRAVAEEGEEEEGWSFGIPRLATVVEVKKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.29
4 0.27
5 0.23
6 0.17
7 0.12
8 0.09
9 0.08
10 0.08
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.09
23 0.11
24 0.11
25 0.11
26 0.13
27 0.13
28 0.13
29 0.16
30 0.16
31 0.16
32 0.17
33 0.17
34 0.19
35 0.25
36 0.3
37 0.36
38 0.43
39 0.51
40 0.6
41 0.7
42 0.77
43 0.81
44 0.85
45 0.85
46 0.83
47 0.74
48 0.71
49 0.63
50 0.56
51 0.48
52 0.39
53 0.31
54 0.24
55 0.22
56 0.15
57 0.12
58 0.1
59 0.08
60 0.06
61 0.05
62 0.06
63 0.07
64 0.08
65 0.11
66 0.14
67 0.19
68 0.22
69 0.22
70 0.22
71 0.22
72 0.21
73 0.21
74 0.21
75 0.15
76 0.13
77 0.13
78 0.13
79 0.13
80 0.12
81 0.1
82 0.07
83 0.07
84 0.08
85 0.1
86 0.11
87 0.11
88 0.14
89 0.15
90 0.15
91 0.14
92 0.13
93 0.11
94 0.1
95 0.09
96 0.06
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.07
111 0.07
112 0.09
113 0.1
114 0.1
115 0.09
116 0.09
117 0.1
118 0.08
119 0.08
120 0.09
121 0.08
122 0.12
123 0.13
124 0.15
125 0.15
126 0.15
127 0.15
128 0.13
129 0.13
130 0.11
131 0.1
132 0.1
133 0.14
134 0.16
135 0.17
136 0.17
137 0.2
138 0.19
139 0.18
140 0.16
141 0.13
142 0.15
143 0.13
144 0.14
145 0.1
146 0.11
147 0.11
148 0.12
149 0.11
150 0.09
151 0.09
152 0.08
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.07
161 0.05
162 0.05
163 0.06
164 0.07
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.08
173 0.07
174 0.11
175 0.11
176 0.11
177 0.13
178 0.13
179 0.15
180 0.2
181 0.27