Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N279

Protein Details
Accession A0A4S2N279    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-52SSLRKAFRKQSLKWHPDKNDHydrophilic
NLS Segment(s)
PositionSequence
89-91KKR
Subcellular Location(s) nucl 16, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
PS50102  RRM  
CDD cd06257  DnaJ  
Amino Acid Sequences MPPNESEAAVFATTSDVDFYDILQIPQDAITESSLRKAFRKQSLKWHPDKNDSAEAVEKFHLLTTAYDVLSDPATKAAYDNARAARLAKKRRNEAFDLERRRMQADLESRENRTKRAKVDPEGEFAAAFSRLKEEGARLRQKREEALRAAAKEAEEQAAKEAEEAGKEEIPASRFTELDRTVTVKWRRKGDGETLDESALRKLFERFGKIQDVVIRKGGGEKKLRNGLIVFESIVGAHAAVRDALNGVNPAFKPFKVVSWAAGKEPDISGIRLDDHGVQGKDPPINPTPPSADGKELPKSPRRAWEPPSASNDGSKKVPSFGSFNLPKSGSLGSQFSKSQMAQSPDYESITLMRMRDAEKRRLEEEIRRQEQAAEDGTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.09
5 0.09
6 0.1
7 0.15
8 0.16
9 0.16
10 0.16
11 0.16
12 0.15
13 0.16
14 0.16
15 0.1
16 0.1
17 0.12
18 0.14
19 0.14
20 0.19
21 0.22
22 0.24
23 0.26
24 0.34
25 0.4
26 0.48
27 0.57
28 0.56
29 0.64
30 0.73
31 0.8
32 0.8
33 0.81
34 0.78
35 0.77
36 0.78
37 0.74
38 0.7
39 0.61
40 0.54
41 0.5
42 0.43
43 0.37
44 0.32
45 0.25
46 0.18
47 0.17
48 0.16
49 0.11
50 0.11
51 0.13
52 0.15
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.15
59 0.11
60 0.09
61 0.1
62 0.1
63 0.1
64 0.14
65 0.17
66 0.19
67 0.24
68 0.24
69 0.25
70 0.26
71 0.28
72 0.3
73 0.35
74 0.44
75 0.46
76 0.52
77 0.61
78 0.68
79 0.72
80 0.69
81 0.68
82 0.67
83 0.69
84 0.69
85 0.64
86 0.59
87 0.54
88 0.5
89 0.43
90 0.34
91 0.31
92 0.31
93 0.33
94 0.38
95 0.39
96 0.41
97 0.49
98 0.49
99 0.47
100 0.47
101 0.46
102 0.44
103 0.51
104 0.55
105 0.53
106 0.6
107 0.57
108 0.53
109 0.49
110 0.44
111 0.33
112 0.26
113 0.21
114 0.14
115 0.12
116 0.08
117 0.08
118 0.09
119 0.09
120 0.1
121 0.12
122 0.19
123 0.28
124 0.37
125 0.38
126 0.43
127 0.47
128 0.48
129 0.51
130 0.49
131 0.46
132 0.4
133 0.43
134 0.42
135 0.38
136 0.37
137 0.32
138 0.26
139 0.21
140 0.19
141 0.14
142 0.11
143 0.1
144 0.1
145 0.1
146 0.1
147 0.09
148 0.09
149 0.07
150 0.07
151 0.09
152 0.09
153 0.08
154 0.08
155 0.09
156 0.1
157 0.1
158 0.11
159 0.12
160 0.11
161 0.11
162 0.11
163 0.16
164 0.15
165 0.15
166 0.15
167 0.16
168 0.16
169 0.24
170 0.32
171 0.34
172 0.38
173 0.42
174 0.43
175 0.43
176 0.46
177 0.45
178 0.45
179 0.41
180 0.39
181 0.35
182 0.33
183 0.31
184 0.28
185 0.21
186 0.14
187 0.1
188 0.09
189 0.09
190 0.14
191 0.16
192 0.2
193 0.21
194 0.24
195 0.27
196 0.27
197 0.27
198 0.28
199 0.29
200 0.25
201 0.24
202 0.21
203 0.17
204 0.23
205 0.25
206 0.26
207 0.3
208 0.31
209 0.35
210 0.42
211 0.42
212 0.37
213 0.34
214 0.3
215 0.25
216 0.23
217 0.17
218 0.11
219 0.11
220 0.09
221 0.09
222 0.07
223 0.05
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.04
230 0.05
231 0.05
232 0.06
233 0.07
234 0.07
235 0.1
236 0.1
237 0.13
238 0.14
239 0.14
240 0.18
241 0.18
242 0.2
243 0.21
244 0.22
245 0.21
246 0.27
247 0.28
248 0.24
249 0.26
250 0.24
251 0.21
252 0.2
253 0.21
254 0.15
255 0.15
256 0.14
257 0.13
258 0.14
259 0.12
260 0.14
261 0.11
262 0.12
263 0.17
264 0.17
265 0.16
266 0.18
267 0.21
268 0.23
269 0.22
270 0.25
271 0.23
272 0.27
273 0.27
274 0.28
275 0.29
276 0.3
277 0.33
278 0.3
279 0.3
280 0.3
281 0.34
282 0.36
283 0.37
284 0.39
285 0.43
286 0.47
287 0.48
288 0.54
289 0.57
290 0.59
291 0.6
292 0.64
293 0.63
294 0.63
295 0.66
296 0.61
297 0.54
298 0.53
299 0.5
300 0.42
301 0.38
302 0.34
303 0.29
304 0.27
305 0.29
306 0.25
307 0.27
308 0.26
309 0.34
310 0.36
311 0.37
312 0.39
313 0.38
314 0.35
315 0.33
316 0.32
317 0.24
318 0.22
319 0.24
320 0.21
321 0.24
322 0.24
323 0.24
324 0.27
325 0.25
326 0.27
327 0.3
328 0.33
329 0.33
330 0.34
331 0.38
332 0.35
333 0.36
334 0.31
335 0.25
336 0.21
337 0.21
338 0.22
339 0.17
340 0.17
341 0.18
342 0.2
343 0.29
344 0.35
345 0.41
346 0.47
347 0.52
348 0.52
349 0.57
350 0.6
351 0.61
352 0.65
353 0.66
354 0.63
355 0.6
356 0.59
357 0.54
358 0.52
359 0.46