Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MK22

Protein Details
Accession A0A4S2MK22    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-51GNYNYRYRYRYRYRYRYRYRYRYRYRYRYRYRYRYRYGTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDELSPSERESGNYNYRYRYRYRYRYRYRYRYRYRYRYRYRYRYRYRYGTTIMKCVSFLLVQHDPGGAITDHHSPTESRPRQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.45
4 0.48
5 0.48
6 0.51
7 0.53
8 0.58
9 0.67
10 0.72
11 0.78
12 0.85
13 0.91
14 0.92
15 0.92
16 0.92
17 0.92
18 0.92
19 0.92
20 0.92
21 0.92
22 0.92
23 0.92
24 0.92
25 0.92
26 0.92
27 0.92
28 0.92
29 0.92
30 0.91
31 0.87
32 0.84
33 0.77
34 0.7
35 0.64
36 0.61
37 0.52
38 0.48
39 0.42
40 0.34
41 0.31
42 0.27
43 0.23
44 0.15
45 0.14
46 0.15
47 0.16
48 0.16
49 0.16
50 0.16
51 0.15
52 0.14
53 0.16
54 0.09
55 0.08
56 0.1
57 0.14
58 0.15
59 0.15
60 0.17
61 0.16
62 0.23
63 0.33
64 0.38