Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N6M2

Protein Details
Accession A0A4S2N6M2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVAAKKHIKIVKKHTKKFNRHQSDLYKCVPSSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
8-16IKIVKKHTK
35-48KPKGIDNRVRRRFK
Subcellular Location(s) mito 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHIKIVKKHTKKFNRHQSDLYKCVPSSWRKPKGIDNRVRRRFKGQAVMPKIGYGSNKKTRHMMPSGHKAFLVQNPSDVELLLMHNRTFAAEIGHAVSSRKRVEILAKAKALGVKVTNPKGRVATDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.89
4 0.91
5 0.91
6 0.9
7 0.85
8 0.84
9 0.83
10 0.81
11 0.76
12 0.69
13 0.61
14 0.51
15 0.49
16 0.47
17 0.44
18 0.46
19 0.51
20 0.57
21 0.56
22 0.6
23 0.66
24 0.71
25 0.74
26 0.73
27 0.73
28 0.75
29 0.81
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.39
60 0.35
61 0.33
62 0.3
63 0.28
64 0.18
65 0.17
66 0.17
67 0.19
68 0.18
69 0.16
70 0.12
71 0.08
72 0.1
73 0.1
74 0.11
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.18
94 0.24
95 0.33
96 0.37
97 0.39
98 0.39
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.46
111 0.46