Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TTR5

Protein Details
Accession A0A4Y7TTR5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-43GVEYQPSQRKRKRKHGFLARKKTVGBasic
NLS Segment(s)
PositionSequence
27-57RKRKRKHGFLARKKTVGGRNVLARRRAKGRK
Subcellular Location(s) mito 14, cyto_nucl 8.5, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences SPASPVLGAVLQARFVQKGVEYQPSQRKRKRKHGFLARKKTVGGRNVLARRRAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.14
6 0.16
7 0.21
8 0.22
9 0.28
10 0.38
11 0.46
12 0.54
13 0.57
14 0.64
15 0.66
16 0.76
17 0.8
18 0.79
19 0.81
20 0.83
21 0.87
22 0.88
23 0.91
24 0.84
25 0.76
26 0.68
27 0.64
28 0.59
29 0.52
30 0.46
31 0.39
32 0.43
33 0.49
34 0.54
35 0.55
36 0.53
37 0.53
38 0.59
39 0.64
40 0.62
41 0.64