Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SRU7

Protein Details
Accession A0A4Y7SRU7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MCKTPPFERWRRSLRHRFWCKTRPGCECHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 5, plas 5, cyto 2, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MCKTPPFERWRRSLRHRFWCKTRPGCECAACVFLLLLLGCRRPTSGSKGVRSVYRLRYDSTAMKRCLQISANIPPTYIQRRFYSVSIRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.86
4 0.85
5 0.86
6 0.85
7 0.85
8 0.83
9 0.81
10 0.76
11 0.69
12 0.67
13 0.59
14 0.52
15 0.43
16 0.36
17 0.27
18 0.21
19 0.17
20 0.11
21 0.09
22 0.07
23 0.07
24 0.06
25 0.07
26 0.08
27 0.08
28 0.08
29 0.1
30 0.12
31 0.18
32 0.26
33 0.3
34 0.32
35 0.36
36 0.37
37 0.36
38 0.38
39 0.37
40 0.34
41 0.35
42 0.34
43 0.33
44 0.33
45 0.35
46 0.39
47 0.41
48 0.43
49 0.39
50 0.41
51 0.41
52 0.4
53 0.4
54 0.34
55 0.3
56 0.28
57 0.34
58 0.37
59 0.35
60 0.35
61 0.32
62 0.37
63 0.41
64 0.4
65 0.35
66 0.32
67 0.37
68 0.4
69 0.42
70 0.45