Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SLX8

Protein Details
Accession A0A4Y7SLX8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-129PQPASRRRLRKATPQPAWRRRLRKATPQLHydrophilic
NLS Segment(s)
PositionSequence
105-125SRRRLRKATPQPAWRRRLRKA
Subcellular Location(s) extr 8, nucl 7, mito 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Amino Acid Sequences MTNLRSESAFRPVDLAALCIERNNQPTKKNGGQWDADIFNGHAIGCNAVSWAPAVVPGSIIDPQQPSSAAHGQPLQPRVVKRFASAGCDNLVKVWGYREDPQPASRRRLRKATPQPAWRRRLRKATPQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.13
4 0.14
5 0.14
6 0.13
7 0.15
8 0.16
9 0.21
10 0.28
11 0.31
12 0.32
13 0.38
14 0.45
15 0.49
16 0.51
17 0.53
18 0.5
19 0.47
20 0.46
21 0.45
22 0.37
23 0.31
24 0.25
25 0.19
26 0.14
27 0.13
28 0.1
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.12
55 0.16
56 0.15
57 0.16
58 0.17
59 0.19
60 0.23
61 0.24
62 0.22
63 0.21
64 0.22
65 0.25
66 0.29
67 0.27
68 0.24
69 0.28
70 0.27
71 0.31
72 0.3
73 0.28
74 0.24
75 0.24
76 0.23
77 0.17
78 0.17
79 0.11
80 0.1
81 0.11
82 0.12
83 0.15
84 0.2
85 0.25
86 0.29
87 0.31
88 0.37
89 0.43
90 0.46
91 0.51
92 0.55
93 0.58
94 0.6
95 0.67
96 0.68
97 0.7
98 0.76
99 0.78
100 0.8
101 0.82
102 0.86
103 0.86
104 0.88
105 0.87
106 0.85
107 0.83
108 0.84
109 0.82