Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DCI9

Protein Details
Accession A5DCI9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MEKNRPKTSQRSRKGKRAWRKNVDIDDVQHydrophilic
NLS Segment(s)
PositionSequence
5-21RPKTSQRSRKGKRAWRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
KEGG pgu:PGUG_00994  -  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MEKNRPKTSQRSRKGKRAWRKNVDIDDVQVGLEENREKLRLVGDEDDFVIDNEGSVNQNQPKKLKTHDILTNKSKIKPLESVRNHNKIQGVDKSKVYKLMKLSGKVMGESKLKARIEKDGLIKKNVTNDLWDTVEEDTTPEILQKFSSHSHTRAKVIPKTLLETSLRLESAKDDEVVGGKIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.9
5 0.91
6 0.9
7 0.9
8 0.89
9 0.85
10 0.81
11 0.71
12 0.62
13 0.53
14 0.43
15 0.33
16 0.24
17 0.18
18 0.11
19 0.12
20 0.11
21 0.1
22 0.12
23 0.13
24 0.13
25 0.14
26 0.16
27 0.16
28 0.18
29 0.2
30 0.2
31 0.2
32 0.2
33 0.19
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.11
44 0.15
45 0.19
46 0.22
47 0.25
48 0.27
49 0.29
50 0.33
51 0.38
52 0.36
53 0.39
54 0.45
55 0.49
56 0.53
57 0.54
58 0.58
59 0.51
60 0.5
61 0.48
62 0.4
63 0.36
64 0.36
65 0.37
66 0.4
67 0.42
68 0.5
69 0.54
70 0.6
71 0.57
72 0.52
73 0.49
74 0.4
75 0.39
76 0.37
77 0.34
78 0.29
79 0.32
80 0.32
81 0.3
82 0.36
83 0.33
84 0.29
85 0.26
86 0.32
87 0.33
88 0.32
89 0.33
90 0.3
91 0.29
92 0.27
93 0.25
94 0.21
95 0.19
96 0.18
97 0.19
98 0.22
99 0.22
100 0.24
101 0.24
102 0.26
103 0.28
104 0.32
105 0.38
106 0.39
107 0.41
108 0.42
109 0.42
110 0.37
111 0.4
112 0.38
113 0.31
114 0.26
115 0.25
116 0.25
117 0.24
118 0.23
119 0.18
120 0.15
121 0.15
122 0.12
123 0.11
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.1
132 0.13
133 0.15
134 0.23
135 0.25
136 0.3
137 0.38
138 0.41
139 0.44
140 0.47
141 0.52
142 0.51
143 0.52
144 0.53
145 0.47
146 0.48
147 0.46
148 0.44
149 0.38
150 0.34
151 0.32
152 0.29
153 0.27
154 0.22
155 0.21
156 0.19
157 0.21
158 0.22
159 0.19
160 0.16
161 0.16
162 0.18