Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SZK5

Protein Details
Accession A0A4Y7SZK5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-122TPPSHKTAVKRPARRPPPRRRRVQSVEKLAPTHydrophilic
NLS Segment(s)
PositionSequence
97-112TAVKRPARRPPPRRRR
Subcellular Location(s) extr 12, mito 10, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035971  CBD_sf  
IPR000254  Cellulose-bd_dom_fun  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030248  F:cellulose binding  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00734  CBM_1  
Amino Acid Sequences MVYGLCNWSITVCLIATLLFLQSAANSPSASPSAVGYRDTCAATLRSSLTTSARGVKLSKLSRTTQTPSDICKKGDPTNPNREGYLPTSSTPPSHKTAVKRPARRPPPRRRRVQSVEKLAPTPVVSVPGYHVPLDGQCGGTGYDGPTVCERFVRFHNSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.05
7 0.05
8 0.05
9 0.05
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.11
16 0.12
17 0.12
18 0.1
19 0.1
20 0.13
21 0.14
22 0.15
23 0.14
24 0.15
25 0.17
26 0.17
27 0.16
28 0.14
29 0.14
30 0.14
31 0.15
32 0.14
33 0.13
34 0.13
35 0.15
36 0.14
37 0.15
38 0.16
39 0.19
40 0.19
41 0.19
42 0.19
43 0.2
44 0.26
45 0.28
46 0.31
47 0.3
48 0.31
49 0.34
50 0.38
51 0.39
52 0.34
53 0.36
54 0.33
55 0.33
56 0.39
57 0.37
58 0.34
59 0.33
60 0.33
61 0.33
62 0.38
63 0.41
64 0.4
65 0.48
66 0.5
67 0.48
68 0.45
69 0.41
70 0.37
71 0.33
72 0.29
73 0.2
74 0.17
75 0.18
76 0.18
77 0.19
78 0.19
79 0.2
80 0.2
81 0.22
82 0.26
83 0.29
84 0.38
85 0.46
86 0.53
87 0.58
88 0.63
89 0.7
90 0.77
91 0.83
92 0.84
93 0.85
94 0.87
95 0.88
96 0.91
97 0.88
98 0.88
99 0.86
100 0.87
101 0.85
102 0.84
103 0.8
104 0.72
105 0.65
106 0.55
107 0.47
108 0.36
109 0.29
110 0.19
111 0.16
112 0.14
113 0.13
114 0.16
115 0.18
116 0.2
117 0.18
118 0.17
119 0.14
120 0.15
121 0.18
122 0.17
123 0.13
124 0.11
125 0.12
126 0.13
127 0.12
128 0.13
129 0.1
130 0.14
131 0.14
132 0.16
133 0.19
134 0.2
135 0.2
136 0.23
137 0.23
138 0.23
139 0.28