Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7U2Z3

Protein Details
Accession A0A4Y7U2Z3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-88EDDAWFKYMKKWNRKQRKGEISNEELHydrophilic
NLS Segment(s)
PositionSequence
76-80RKQRK
93-103RRWQKKHGKKA
Subcellular Location(s) cyto 12.5, cyto_nucl 9.833, cyto_pero 8.166, mito 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MEKVAGRPASDVEKDLVMKWVVDSSEVIMRNVITREYLNFPAEPGIGIQGDPGEVDDSMAKAEDDAWFKYMKKWNRKQRKGEISNEELGEAFRRWQKKHGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.17
5 0.16
6 0.15
7 0.15
8 0.13
9 0.13
10 0.12
11 0.11
12 0.15
13 0.16
14 0.16
15 0.14
16 0.14
17 0.15
18 0.15
19 0.13
20 0.1
21 0.09
22 0.12
23 0.15
24 0.18
25 0.17
26 0.17
27 0.17
28 0.16
29 0.16
30 0.13
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.04
48 0.04
49 0.05
50 0.07
51 0.09
52 0.1
53 0.11
54 0.12
55 0.13
56 0.2
57 0.27
58 0.33
59 0.42
60 0.52
61 0.62
62 0.72
63 0.82
64 0.85
65 0.88
66 0.91
67 0.87
68 0.86
69 0.83
70 0.77
71 0.72
72 0.62
73 0.51
74 0.4
75 0.34
76 0.27
77 0.2
78 0.19
79 0.2
80 0.27
81 0.29
82 0.38
83 0.48