Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DIA5

Protein Details
Accession A5DIA5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-122SKAVERYRRDQKKTQFNKKMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025212  CAD_CENP-Q  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
KEGG pgu:PGUG_03006  -  
Pfam View protein in Pfam  
PF13094  CENP-Q  
Amino Acid Sequences MSDRDGTDNINSPNRSPQSPALPDTPHSPPSPSHSSRTKSPENHESIEEPNEAKTSQIGLPTNFTLQTVRKRVPGKLVDRFWAPLDPETFNSLERIISVCSSKAVERYRRDQKKTQFNKKMASAQEIVANSWADRNNKSSFLSRLKVTKVPLPTSHSKRNSSEDMNVLAFDSLNRRKKFLETYLQAELKQVNQLEKYHKELSTVYQQDLQYLQEFKKTTEIEIKSMTEEATELRRNMGLENSKNTPEGEYVEKPVKPFNPNDDPETRQLLTEIRDKLAPLQEKCKELAEADDALDVLYNFLDIEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.41
4 0.42
5 0.44
6 0.48
7 0.5
8 0.46
9 0.45
10 0.44
11 0.45
12 0.44
13 0.38
14 0.34
15 0.33
16 0.29
17 0.35
18 0.42
19 0.41
20 0.43
21 0.47
22 0.51
23 0.56
24 0.62
25 0.64
26 0.61
27 0.65
28 0.68
29 0.66
30 0.64
31 0.58
32 0.53
33 0.47
34 0.44
35 0.38
36 0.28
37 0.23
38 0.22
39 0.19
40 0.17
41 0.14
42 0.14
43 0.14
44 0.18
45 0.2
46 0.19
47 0.23
48 0.23
49 0.24
50 0.21
51 0.2
52 0.18
53 0.21
54 0.28
55 0.32
56 0.32
57 0.38
58 0.41
59 0.43
60 0.49
61 0.53
62 0.52
63 0.54
64 0.55
65 0.51
66 0.5
67 0.49
68 0.41
69 0.35
70 0.29
71 0.23
72 0.23
73 0.22
74 0.21
75 0.23
76 0.22
77 0.19
78 0.18
79 0.15
80 0.12
81 0.11
82 0.11
83 0.09
84 0.09
85 0.1
86 0.09
87 0.1
88 0.11
89 0.11
90 0.17
91 0.23
92 0.3
93 0.34
94 0.42
95 0.52
96 0.6
97 0.66
98 0.68
99 0.7
100 0.74
101 0.79
102 0.82
103 0.81
104 0.76
105 0.75
106 0.71
107 0.68
108 0.58
109 0.52
110 0.43
111 0.34
112 0.33
113 0.28
114 0.24
115 0.18
116 0.16
117 0.12
118 0.13
119 0.15
120 0.14
121 0.15
122 0.18
123 0.19
124 0.21
125 0.22
126 0.23
127 0.25
128 0.28
129 0.29
130 0.27
131 0.28
132 0.29
133 0.3
134 0.29
135 0.28
136 0.27
137 0.27
138 0.28
139 0.3
140 0.35
141 0.39
142 0.46
143 0.47
144 0.47
145 0.47
146 0.49
147 0.48
148 0.42
149 0.39
150 0.31
151 0.28
152 0.25
153 0.22
154 0.17
155 0.13
156 0.1
157 0.08
158 0.12
159 0.18
160 0.26
161 0.27
162 0.28
163 0.29
164 0.33
165 0.38
166 0.38
167 0.39
168 0.34
169 0.38
170 0.42
171 0.42
172 0.39
173 0.35
174 0.3
175 0.21
176 0.21
177 0.18
178 0.14
179 0.15
180 0.18
181 0.23
182 0.25
183 0.3
184 0.31
185 0.3
186 0.3
187 0.28
188 0.3
189 0.33
190 0.33
191 0.28
192 0.29
193 0.29
194 0.28
195 0.28
196 0.25
197 0.18
198 0.19
199 0.18
200 0.18
201 0.19
202 0.18
203 0.25
204 0.24
205 0.23
206 0.3
207 0.31
208 0.29
209 0.31
210 0.31
211 0.25
212 0.25
213 0.23
214 0.14
215 0.12
216 0.11
217 0.14
218 0.17
219 0.16
220 0.17
221 0.18
222 0.18
223 0.19
224 0.24
225 0.26
226 0.27
227 0.31
228 0.34
229 0.34
230 0.34
231 0.34
232 0.29
233 0.22
234 0.22
235 0.23
236 0.22
237 0.25
238 0.29
239 0.3
240 0.29
241 0.34
242 0.36
243 0.35
244 0.37
245 0.41
246 0.45
247 0.47
248 0.52
249 0.52
250 0.51
251 0.5
252 0.52
253 0.43
254 0.34
255 0.32
256 0.29
257 0.27
258 0.3
259 0.29
260 0.25
261 0.25
262 0.26
263 0.3
264 0.35
265 0.39
266 0.36
267 0.43
268 0.47
269 0.48
270 0.49
271 0.47
272 0.4
273 0.33
274 0.33
275 0.27
276 0.24
277 0.22
278 0.2
279 0.17
280 0.15
281 0.15
282 0.11
283 0.08
284 0.06
285 0.06
286 0.05
287 0.05