Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DGX6

Protein Details
Accession A5DGX6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-35KGSIRLPVKAQKPKKDNKKAEKEPEVAQHydrophilic
NLS Segment(s)
PositionSequence
8-28KGSIRLPVKAQKPKKDNKKAE
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
KEGG pgu:PGUG_02527  -  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MAKKTGVKGSIRLPVKAQKPKKDNKKAEKEPEVAQDSPSDDLDDEDDVDEDDSEASGSESEASESESESDAESEAESEAESGSESDSDAMPKKKRKTGDGSQEFANAFNAIIGSKLKAHRRNDPIMARSKNVQKQLDSAKLEAKAKKQLLAEKKALHDSHRVKNLLPSANEPEKVRSMIEDEKKLKKVAQRGVVRLFNAVLSTQIKTTQEVSGEKVGLVRKEELLNEVSKEQFLDLVQAAGHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.58
4 0.62
5 0.63
6 0.7
7 0.79
8 0.85
9 0.88
10 0.9
11 0.9
12 0.92
13 0.92
14 0.92
15 0.9
16 0.83
17 0.76
18 0.74
19 0.68
20 0.57
21 0.48
22 0.39
23 0.32
24 0.3
25 0.26
26 0.18
27 0.13
28 0.13
29 0.13
30 0.12
31 0.11
32 0.09
33 0.09
34 0.08
35 0.08
36 0.08
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.08
56 0.09
57 0.08
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.07
75 0.11
76 0.16
77 0.22
78 0.3
79 0.35
80 0.4
81 0.43
82 0.48
83 0.52
84 0.56
85 0.62
86 0.6
87 0.57
88 0.53
89 0.51
90 0.45
91 0.37
92 0.28
93 0.17
94 0.1
95 0.08
96 0.07
97 0.04
98 0.05
99 0.05
100 0.05
101 0.08
102 0.12
103 0.2
104 0.27
105 0.3
106 0.38
107 0.43
108 0.47
109 0.5
110 0.5
111 0.47
112 0.48
113 0.47
114 0.4
115 0.38
116 0.42
117 0.4
118 0.43
119 0.41
120 0.33
121 0.36
122 0.4
123 0.43
124 0.37
125 0.33
126 0.3
127 0.31
128 0.35
129 0.33
130 0.31
131 0.32
132 0.31
133 0.34
134 0.33
135 0.37
136 0.41
137 0.44
138 0.45
139 0.41
140 0.42
141 0.44
142 0.43
143 0.38
144 0.4
145 0.4
146 0.42
147 0.46
148 0.45
149 0.39
150 0.43
151 0.47
152 0.42
153 0.37
154 0.34
155 0.34
156 0.37
157 0.39
158 0.35
159 0.32
160 0.3
161 0.29
162 0.25
163 0.19
164 0.2
165 0.26
166 0.31
167 0.36
168 0.39
169 0.45
170 0.47
171 0.48
172 0.47
173 0.44
174 0.47
175 0.47
176 0.51
177 0.51
178 0.54
179 0.6
180 0.6
181 0.55
182 0.47
183 0.4
184 0.3
185 0.24
186 0.18
187 0.14
188 0.13
189 0.13
190 0.13
191 0.16
192 0.17
193 0.18
194 0.2
195 0.19
196 0.21
197 0.22
198 0.25
199 0.25
200 0.25
201 0.23
202 0.24
203 0.26
204 0.24
205 0.26
206 0.24
207 0.23
208 0.25
209 0.26
210 0.25
211 0.25
212 0.24
213 0.24
214 0.25
215 0.23
216 0.21
217 0.2
218 0.17
219 0.16
220 0.14
221 0.15
222 0.13
223 0.12