Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TKI3

Protein Details
Accession A0A4Y7TKI3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSSKRGRKRNDNLPPNRARDHydrophilic
NLS Segment(s)
PositionSequence
7-10GRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLQALEQRVTELEEENAYLRQTLHLPPANRPPLGRGPTGKDRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.79
4 0.74
5 0.68
6 0.61
7 0.59
8 0.58
9 0.57
10 0.58
11 0.61
12 0.59
13 0.6
14 0.62
15 0.53
16 0.52
17 0.5
18 0.45
19 0.4
20 0.38
21 0.34
22 0.33
23 0.34
24 0.28
25 0.21
26 0.18
27 0.14
28 0.14
29 0.13
30 0.08
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.08
37 0.08
38 0.07
39 0.08
40 0.1
41 0.12
42 0.18
43 0.22
44 0.24
45 0.28
46 0.38
47 0.42
48 0.41
49 0.4
50 0.39
51 0.43
52 0.46
53 0.46
54 0.41
55 0.44