Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SN95

Protein Details
Accession A0A4Y7SN95   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-52ELDAEERKQRKRERKEAKRAARAALBasic
172-199VTISAPPRPPKERKKRVAARKGWKGWIEHydrophilic
NLS Segment(s)
PositionSequence
34-49RKQRKRERKEAKRAAR
177-196PPRPPKERKKRVAARKGWKG
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAGNFDLPTARDVLTSLLNGVGPYKEVELDAEERKQRKRERKEAKRAARAALEASGSNAMVSYSATAPPAPATSSTTITVTTSNPTTTAMPRIIHLKSSSFWKSKSTTHTQSRPEIMIASVQRSVSVTPPPMSLQPTPECTPGPSVSSATSHESLKRLHTPGDDEDIDHRHVTISAPPRPPKERKKRVAARKGWKGWIEGSPPPSEKLINLDAVPILQERRTRSGKNFDGIGEGKDGWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.11
5 0.11
6 0.11
7 0.12
8 0.1
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.13
16 0.17
17 0.19
18 0.24
19 0.3
20 0.34
21 0.41
22 0.48
23 0.55
24 0.62
25 0.69
26 0.74
27 0.79
28 0.85
29 0.9
30 0.93
31 0.93
32 0.92
33 0.85
34 0.78
35 0.7
36 0.6
37 0.5
38 0.4
39 0.31
40 0.21
41 0.19
42 0.15
43 0.12
44 0.1
45 0.09
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.08
58 0.08
59 0.11
60 0.13
61 0.15
62 0.16
63 0.15
64 0.15
65 0.15
66 0.15
67 0.13
68 0.13
69 0.12
70 0.11
71 0.11
72 0.12
73 0.13
74 0.13
75 0.16
76 0.16
77 0.15
78 0.16
79 0.2
80 0.19
81 0.19
82 0.19
83 0.17
84 0.15
85 0.21
86 0.26
87 0.24
88 0.24
89 0.26
90 0.28
91 0.31
92 0.37
93 0.38
94 0.41
95 0.46
96 0.52
97 0.52
98 0.53
99 0.51
100 0.45
101 0.37
102 0.29
103 0.22
104 0.19
105 0.15
106 0.13
107 0.12
108 0.11
109 0.11
110 0.11
111 0.11
112 0.09
113 0.11
114 0.11
115 0.11
116 0.12
117 0.12
118 0.14
119 0.16
120 0.15
121 0.18
122 0.18
123 0.22
124 0.23
125 0.23
126 0.22
127 0.2
128 0.22
129 0.19
130 0.18
131 0.15
132 0.14
133 0.14
134 0.14
135 0.16
136 0.16
137 0.17
138 0.16
139 0.17
140 0.18
141 0.19
142 0.22
143 0.25
144 0.23
145 0.23
146 0.24
147 0.26
148 0.26
149 0.3
150 0.26
151 0.22
152 0.23
153 0.24
154 0.24
155 0.2
156 0.18
157 0.13
158 0.13
159 0.13
160 0.17
161 0.21
162 0.27
163 0.34
164 0.39
165 0.44
166 0.52
167 0.6
168 0.65
169 0.69
170 0.73
171 0.75
172 0.82
173 0.86
174 0.89
175 0.91
176 0.9
177 0.89
178 0.89
179 0.86
180 0.82
181 0.74
182 0.65
183 0.58
184 0.53
185 0.47
186 0.41
187 0.39
188 0.37
189 0.36
190 0.35
191 0.33
192 0.28
193 0.24
194 0.25
195 0.24
196 0.22
197 0.2
198 0.2
199 0.18
200 0.17
201 0.18
202 0.14
203 0.13
204 0.14
205 0.18
206 0.22
207 0.3
208 0.36
209 0.4
210 0.46
211 0.55
212 0.57
213 0.58
214 0.55
215 0.48
216 0.48
217 0.44
218 0.38
219 0.31