Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DP13

Protein Details
Accession A5DP13    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-101DANERIKRSRERQKEYEKRRREREEEMYBasic
NLS Segment(s)
PositionSequence
79-95IKRSRERQKEYEKRRRE
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG pgu:PGUG_05014  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MISGCSSRTQLEATGFRCIIMHPQLDRVRFDTCESLMDALEECHRQEFLKQALGSCNFEKDELAKCIHHTRLNDANERIKRSRERQKEYEKRRREREEEMYGKNNYLKKMIEQEAAKKTGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.28
5 0.25
6 0.25
7 0.24
8 0.26
9 0.2
10 0.29
11 0.34
12 0.36
13 0.37
14 0.34
15 0.32
16 0.29
17 0.31
18 0.25
19 0.21
20 0.2
21 0.19
22 0.17
23 0.14
24 0.13
25 0.11
26 0.09
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.15
35 0.15
36 0.19
37 0.19
38 0.2
39 0.23
40 0.25
41 0.27
42 0.22
43 0.22
44 0.16
45 0.16
46 0.16
47 0.13
48 0.14
49 0.14
50 0.15
51 0.14
52 0.16
53 0.2
54 0.23
55 0.25
56 0.22
57 0.26
58 0.32
59 0.35
60 0.38
61 0.36
62 0.42
63 0.42
64 0.47
65 0.43
66 0.41
67 0.45
68 0.49
69 0.57
70 0.59
71 0.64
72 0.68
73 0.77
74 0.82
75 0.86
76 0.88
77 0.88
78 0.87
79 0.88
80 0.88
81 0.82
82 0.8
83 0.78
84 0.78
85 0.74
86 0.71
87 0.67
88 0.59
89 0.56
90 0.52
91 0.47
92 0.38
93 0.35
94 0.31
95 0.29
96 0.36
97 0.38
98 0.4
99 0.4
100 0.46
101 0.5