Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7RPQ1

Protein Details
Accession A0A4Y7RPQ1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
91-116VECRSKLSFRLPRRIRKGRQEVYGTFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 5, extr 5, plas 3
Family & Domain DBs
Amino Acid Sequences MASFGLSLLPFCCPLHPLLGPSGGCMCRRWVCRGGNFQRGGGDHMVTLKMDPASSLLMAGRTTCSLVTCRRIWLSNRYPATSSAARCSMNVECRSKLSFRLPRRIRKGRQEVYGTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.17
4 0.18
5 0.18
6 0.22
7 0.21
8 0.21
9 0.25
10 0.22
11 0.22
12 0.22
13 0.25
14 0.26
15 0.3
16 0.34
17 0.37
18 0.4
19 0.46
20 0.55
21 0.57
22 0.6
23 0.58
24 0.52
25 0.47
26 0.43
27 0.39
28 0.29
29 0.22
30 0.13
31 0.13
32 0.13
33 0.1
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.05
51 0.06
52 0.08
53 0.11
54 0.16
55 0.16
56 0.19
57 0.2
58 0.23
59 0.26
60 0.33
61 0.37
62 0.4
63 0.42
64 0.42
65 0.41
66 0.39
67 0.42
68 0.36
69 0.31
70 0.27
71 0.28
72 0.27
73 0.26
74 0.28
75 0.26
76 0.3
77 0.35
78 0.35
79 0.33
80 0.35
81 0.39
82 0.37
83 0.37
84 0.39
85 0.43
86 0.47
87 0.56
88 0.62
89 0.7
90 0.79
91 0.84
92 0.83
93 0.85
94 0.88
95 0.84
96 0.85