Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T0I1

Protein Details
Accession A0A4Y7T0I1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSPCRSRGKPQAASKRMRRLVGHydrophilic
NLS Segment(s)
PositionSequence
9-25KPQAASKRMRRLVGDRR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSPCRSRGKPQAASKRMRRLVGDRRRPALNGHDLQIPPAPMGPKTMQETTLGDFGGDYSTPLSDSDSDGPSPMGVPSGKTRMGISHAGREFGVLFEDLQTPGMSKSFERMPLLVDAYLKWKTELGNASLRQAVPPPPSVEASNPRKVKVVDPFSIYEYNMGIVEADASTVCAHIRHSIVPSLYGGPFGEKGSFEVAQLCGIRAKFETRSATFENPAQPSRTRRNFVIAARNSCDGERNSFGWAQLFARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.82
4 0.76
5 0.71
6 0.69
7 0.71
8 0.73
9 0.74
10 0.71
11 0.69
12 0.68
13 0.64
14 0.58
15 0.56
16 0.55
17 0.47
18 0.42
19 0.44
20 0.41
21 0.42
22 0.4
23 0.32
24 0.22
25 0.22
26 0.21
27 0.14
28 0.19
29 0.19
30 0.21
31 0.25
32 0.26
33 0.25
34 0.25
35 0.27
36 0.25
37 0.25
38 0.2
39 0.15
40 0.13
41 0.12
42 0.11
43 0.09
44 0.07
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.08
51 0.11
52 0.13
53 0.15
54 0.15
55 0.15
56 0.15
57 0.13
58 0.13
59 0.1
60 0.09
61 0.07
62 0.09
63 0.12
64 0.16
65 0.17
66 0.17
67 0.17
68 0.16
69 0.2
70 0.25
71 0.23
72 0.27
73 0.27
74 0.27
75 0.26
76 0.25
77 0.22
78 0.15
79 0.15
80 0.07
81 0.06
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.09
93 0.11
94 0.13
95 0.14
96 0.13
97 0.14
98 0.15
99 0.16
100 0.14
101 0.12
102 0.1
103 0.12
104 0.14
105 0.12
106 0.11
107 0.11
108 0.11
109 0.14
110 0.16
111 0.15
112 0.2
113 0.2
114 0.21
115 0.22
116 0.21
117 0.18
118 0.18
119 0.18
120 0.14
121 0.16
122 0.16
123 0.16
124 0.17
125 0.17
126 0.19
127 0.25
128 0.29
129 0.35
130 0.35
131 0.34
132 0.36
133 0.36
134 0.38
135 0.38
136 0.37
137 0.31
138 0.33
139 0.34
140 0.34
141 0.34
142 0.3
143 0.21
144 0.15
145 0.14
146 0.1
147 0.09
148 0.06
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.06
160 0.09
161 0.1
162 0.11
163 0.13
164 0.16
165 0.16
166 0.17
167 0.17
168 0.17
169 0.16
170 0.15
171 0.13
172 0.11
173 0.12
174 0.12
175 0.12
176 0.1
177 0.11
178 0.14
179 0.14
180 0.13
181 0.14
182 0.13
183 0.15
184 0.15
185 0.15
186 0.14
187 0.14
188 0.16
189 0.15
190 0.19
191 0.18
192 0.24
193 0.3
194 0.28
195 0.34
196 0.38
197 0.4
198 0.38
199 0.39
200 0.4
201 0.38
202 0.39
203 0.36
204 0.37
205 0.41
206 0.5
207 0.55
208 0.53
209 0.51
210 0.56
211 0.58
212 0.6
213 0.63
214 0.59
215 0.57
216 0.56
217 0.56
218 0.5
219 0.44
220 0.43
221 0.35
222 0.34
223 0.32
224 0.29
225 0.3
226 0.3
227 0.31
228 0.27
229 0.27