Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DBZ6

Protein Details
Accession A5DBZ6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
132-163DNSKNGAHSKSKKQKGKRKASSGRKSNKKQKKBasic
NLS Segment(s)
PositionSequence
138-163AHSKSKKQKGKRKASSGRKSNKKQKK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG pgu:PGUG_00801  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSGLSSRVKSMKFMQQVRPAGSEDIEESPQKKVSLSSEWTLPHAAEVLKRSRQKPQVDTIGYGSISAFDTSDETAVPQGRKVWGKPEESIRQIDIGRIKDSIIDEKAGKAGKAGQDAEENAEDDDSGDDSGDNSKNGAHSKSKKQKGKRKASSGRKSNKKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.64
4 0.63
5 0.59
6 0.52
7 0.44
8 0.38
9 0.3
10 0.23
11 0.21
12 0.2
13 0.2
14 0.19
15 0.2
16 0.22
17 0.21
18 0.19
19 0.19
20 0.2
21 0.24
22 0.27
23 0.27
24 0.28
25 0.29
26 0.3
27 0.28
28 0.24
29 0.18
30 0.15
31 0.14
32 0.12
33 0.16
34 0.19
35 0.26
36 0.32
37 0.33
38 0.41
39 0.48
40 0.52
41 0.53
42 0.55
43 0.57
44 0.53
45 0.52
46 0.45
47 0.39
48 0.32
49 0.27
50 0.19
51 0.11
52 0.1
53 0.09
54 0.07
55 0.05
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.09
63 0.09
64 0.09
65 0.1
66 0.13
67 0.15
68 0.15
69 0.21
70 0.23
71 0.26
72 0.27
73 0.33
74 0.35
75 0.35
76 0.36
77 0.29
78 0.27
79 0.25
80 0.25
81 0.23
82 0.2
83 0.18
84 0.17
85 0.16
86 0.16
87 0.17
88 0.18
89 0.14
90 0.14
91 0.14
92 0.14
93 0.17
94 0.16
95 0.15
96 0.11
97 0.14
98 0.15
99 0.18
100 0.18
101 0.17
102 0.18
103 0.19
104 0.21
105 0.18
106 0.16
107 0.13
108 0.12
109 0.1
110 0.09
111 0.09
112 0.07
113 0.06
114 0.06
115 0.05
116 0.06
117 0.1
118 0.11
119 0.1
120 0.1
121 0.11
122 0.14
123 0.17
124 0.21
125 0.26
126 0.33
127 0.44
128 0.55
129 0.64
130 0.7
131 0.78
132 0.85
133 0.86
134 0.9
135 0.9
136 0.9
137 0.91
138 0.93
139 0.93
140 0.93
141 0.93
142 0.92
143 0.93