Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T552

Protein Details
Accession A0A4Y7T552   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-100INPNRTLKDRGKRMRAKIQIQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MAIRVRRSQVSIPLVSFTTSLGMSVSKLDGEARHGPPTLARYHVHNLRRGFDKWPLYWVGFRNPSILEPGRYHPTFHPFINPNRTLKDRGKRMRAKIQIQEGRSLLRTSPTIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.27
4 0.18
5 0.13
6 0.1
7 0.1
8 0.08
9 0.08
10 0.07
11 0.08
12 0.08
13 0.06
14 0.07
15 0.08
16 0.08
17 0.13
18 0.19
19 0.21
20 0.23
21 0.23
22 0.23
23 0.23
24 0.26
25 0.22
26 0.19
27 0.18
28 0.2
29 0.26
30 0.33
31 0.34
32 0.38
33 0.38
34 0.37
35 0.41
36 0.38
37 0.35
38 0.34
39 0.35
40 0.29
41 0.3
42 0.28
43 0.25
44 0.26
45 0.24
46 0.23
47 0.22
48 0.22
49 0.21
50 0.2
51 0.19
52 0.22
53 0.21
54 0.18
55 0.18
56 0.21
57 0.26
58 0.26
59 0.28
60 0.25
61 0.3
62 0.3
63 0.29
64 0.33
65 0.3
66 0.37
67 0.44
68 0.45
69 0.42
70 0.44
71 0.47
72 0.46
73 0.51
74 0.54
75 0.55
76 0.61
77 0.69
78 0.73
79 0.77
80 0.81
81 0.82
82 0.8
83 0.77
84 0.79
85 0.75
86 0.69
87 0.66
88 0.57
89 0.51
90 0.45
91 0.39
92 0.29
93 0.26